Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 17.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (2)

AA Sequence

MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSWILALVFSLSL      1 - 70
LPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVGTVGALPVDDPTLREKRLQLF     71 - 140
HLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNIQLSAMGLYQSLGFKKTGQSFFHVWARLVDL    141 - 210
HTVHFIYHLPSAQAGRL                                                         211 - 227
//

Text Mined References (9)

PMID Year Title