Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 17.09

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
25301944 ATase1 and ATase2 are endoplasmic reticulum-based acetyltransferases that form homo- and heterodimers and associate with members of the oligosaccharyltransferase complex
22267734 Biochemical inhibition of the acetyltransferases ATase1 and ATase2 reduces beta-secretase (BACE1) levels and Abeta generation.

AA Sequence

MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSWILALVFSLSL      1 - 70
LPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVGTVGALPVDDPTLREKRLQLF     71 - 140
HLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNIQLSAMGLYQSLGFKKTGQSFFHVWARLVDL    141 - 210
HTVHFIYHLPSAQAGRL                                                         211 - 227
//

Text Mined References (9)

PMID Year Title
25301944 2014 The endoplasmic reticulum-based acetyltransferases, ATase1 and ATase2, associate with the oligosaccharyltransferase to acetylate correctly folded polypeptides.
24556617 2014 Post-translational regulation of CD133 by ATase1/ATase2-mediated lysine acetylation.
22267734 2012 Biochemical inhibition of the acetyltransferases ATase1 and ATase2 reduces ?-secretase (BACE1) levels and A? generation.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20383145 2010 Genetic loci influencing kidney function and chronic kidney disease.
19011241 2009 Two endoplasmic reticulum (ER)/ER Golgi intermediate compartment-based lysine acetyltransferases post-translationally regulate BACE1 levels.
16395595 2006 Human-specific nonsense mutations identified by genome sequence comparisons.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11397015 2001 Overexpression of camello, a member of a novel protein family, reduces blastomere adhesion and inhibits gastrulation in Xenopus laevis.