Property Summary

NCBI Gene PubMed Count 47
Grant Count 14
R01 Count 13
Funding $1,201,294.97
PubMed Score 65.02
PubTator Score 59.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.400 0.000
non-small cell lung cancer -1.551 0.000
breast carcinoma -1.100 0.002
adult high grade glioma -1.200 0.000
posterior fossa group B ependymoma -1.100 0.000
lung adenocarcinoma -1.200 0.000

Gene RIF (37)

PMID Text
26542361 The preferential expression of EGFL7 in less differentiated hepatocellular carcinoma compared to VEGF, suggests a possible important role of this angiogenic factor in a later oncogenic and infiltrative/metastatic phase.
26504055 Loss of EGFL7 expression is associated with Malignant Pleural Mesothelioma.
26288231 EGFR mutational analysis is useful in the diagnosis of non-small-cell-lung cancer.
25987088 High EGFL7 expression promotes migration and Epithelial-Mesenchymal Transition in pancreatic Cancer.
25730089 EGFL7, OPN, and PGE2 may have a role in recurrence and metastasis of hepatocellular carcinoma
25667199 Data suggest that, in trophoblast cells, EGFL7 regulates cell migration and invasion/placentation by activating multiple signaling pathways via MAPK, PI3K (phosphatidylinositol 3-kinase), and NOTCH1 (translocation-associated notch protein 1).
25601205 Endothelial cells control pancreatic cell fate at defined stages through EGFL7 signaling.
25592646 The aim of the present descriptive study was to analyse the intra-tumoural expressions of epidermal growth factor-like domain 7 (EGFL7) and microRNA-126 (miRNA-126) in primary tumours from patients with stage II-IV colorectal cancer.
25140000 EGFL7 may predict response to first-line chemotherapy and bevacizumab in patients with metastatic colorectal cancer
24945379 EGFL7 enhances EGFR-AKT signaling, epithelial-mesenchymal transition, and metastasis of gastric cancer cells.
More...

AA Sequence

MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYR      1 - 70
TAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDE     71 - 140
CSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLL    141 - 210
EEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS           211 - 273
//

Text Mined References (49)

PMID Year Title
26542361 2016 Different expression of VEGF and EGFL7 in human hepatocellular carcinoma.
26504055 2015 Methylation-associated Silencing of microRNA-126 and its Host Gene EGFL7 in Malignant Pleural Mesothelioma.
26288231 2015 Preanalytic parameters in epidermal growth factor receptor mutation testing for non-small cell lung carcinoma: A review of cytologic series.
25987088 2015 Suppression of the Epidermal Growth Factor-like Domain 7 and Inhibition of Migration and Epithelial-Mesenchymal Transition in Human Pancreatic Cancer PANC-1 Cells.
25730089 2015 Multivariate analysis of molecular markers in peripheral blood associated with recurrence and metastasis of hepatocellular carcinoma.
25667199 2015 Epidermal growth factor-like domain 7 promotes migration and invasion of human trophoblast cells through activation of MAPK, PI3K and NOTCH signaling pathways.
25601205 2015 Endothelial cells control pancreatic cell fate at defined stages through EGFL7 signaling.
25592646 2015 Intra-tumoural vessel area estimated by expression of epidermal growth factor-like domain 7 and microRNA-126 in primary tumours and metastases of patients with colorectal cancer: a descriptive study.
25140000 2014 Epidermal growth factor-like domain 7 predicts response to first-line chemotherapy and bevacizumab in patients with metastatic colorectal cancer.
24945379 2014 Epidermal growth factor-like domain-containing protein 7 (EGFL7) enhances EGF receptor-AKT signaling, epithelial-mesenchymal transition, and metastasis of gastric cancer cells.
More...