Property Summary

NCBI Gene PubMed Count 54
PubMed Score 72.84
PubTator Score 59.43

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 2.7e-04
breast carcinoma -1.100 1.6e-03
group 4 medulloblastoma -1.400 2.9e-05
lung adenocarcinoma -1.200 7.4e-05
medulloblastoma, large-cell -1.400 4.4e-05
non-small cell lung cancer -1.551 9.1e-18
posterior fossa group B ependymoma -1.100 4.2e-08

Gene RIF (45)

AA Sequence

MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYR      1 - 70
TAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDE     71 - 140
CSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLL    141 - 210
EEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS           211 - 273
//

Text Mined References (56)

PMID Year Title