Property Summary

Ligand Count 6
NCBI Gene PubMed Count 61
PubMed Score 422.56
PubTator Score 239.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.300 3.0e-29
Astrocytoma, Pilocytic -1.600 5.2e-04
atypical teratoid / rhabdoid tumor -1.500 5.4e-03
cutaneous lupus erythematosus -1.300 1.7e-03
ependymoma -1.300 1.0e-02
glioblastoma -1.300 4.3e-02
group 3 medulloblastoma -2.100 8.5e-03
interstitial cystitis -2.200 2.1e-02
oligodendroglioma -1.300 3.8e-03
psoriasis -1.700 1.6e-10

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (42)

AA Sequence

MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTD      1 - 70
PKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE                        71 - 121
//

Text Mined References (61)

PMID Year Title