Property Summary

NCBI Gene PubMed Count 60
Grant Count 85
R01 Count 46
Funding $7,885,306.81
PubMed Score 402.54
PubTator Score 239.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group A ependymoma -1.500 0.000
oligodendroglioma -1.300 0.004
cutaneous lupus erythematosus -1.300 0.002
astrocytoma -1.300 0.000
glioblastoma -1.300 0.043
group 3 medulloblastoma -2.100 0.008
atypical teratoid / rhabdoid tumor -1.500 0.005
interstitial cystitis -2.200 0.021
pilocytic astrocytoma -1.600 0.000
psoriasis -1.700 0.000

Synonym

Accession Q9UHF0 Q6IAG2 Q71BC6 Q71BC9
Symbols NKB
HH10
NKNB
PRO1155
ZNEUROK1

Gene

PDB

1P9F  

Gene RIF (41)

PMID Text
25647283 Plasma neurokinin B level is higher in patients with NDHT, indicating an unfavorable cardiovascular prognosis.
25153567 Amino acid substitution A63P in TAC3 gene was statistically associated with the puberty onset time in Chinese girls.
25084101 Colocalization experiments provided evidence for the presence of cocaine- and amphetamine-regulated transcript (CART) in KP-immunoreactive (IR) and perikarya and in KP-IR and NKB-IR axon varicosities.
24802197 mutations in TAC and TACR3 are not a common cause for ICPP.
23977290 SP may influence the KP and NKB secretory output via additional autocrine/paracrine mechanisms or regulate GnRH neurosecretion directly.
23875773 Copper can enter cultured astrocytoma cells and subsequently open plasma membrane calcium channels, but when bound to NKB, copper ion uptake is inhibited.
23656837 Expression of the gene encoding NKB (TAC3) is up-regulated 20-fold in leiomyomas, compared with matched myometrium.
23550013 Interactions between kisspeptins and neurokinin B.
23329188 Rare variants in the TAC3 and TACR3 genes were identified in patients with central pubertal disorders and loss-of-function variants of TACR3 were associated with the normosmic IHH phenotype.
23019350 Sex differences in the neurokinin B system in the human infundibular nucleus.
More...

AA Sequence

MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTD      1 - 70
PKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE                        71 - 121
//

Text Mined References (60)

PMID Year Title
25647283 2015 Serum neurokinin B levels in newly diagnosed nondipper hypertensive patients.
25153567 2015 Association study of TAC3 and TACR3 gene polymorphisms with idiopathic precocious puberty in Chinese girls.
25084101 2014 Colocalization of cocaine- and amphetamine-regulated transcript with kisspeptin and neurokinin B in the human infundibular region.
24802197 2014 Mutational analysis of TAC and TACR3 in idiopathic central precocious puberty.
24356581 2014 The role of neurokinin B signalling in reproductive neuroendocrinology.
23977290 2013 Substance P immunoreactivity exhibits frequent colocalization with kisspeptin and neurokinin B in the human infundibular region.
23875773 2013 The tachykinin peptide neurokinin B binds copper forming an unusual [CuII(NKB)2] complex and inhibits copper uptake into 1321N1 astrocytoma cells.
23656837 2013 Differentially regulated expression of neurokinin B (NKB)/NK3 receptor system in uterine leiomyomata.
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
More...