Property Summary

NCBI Gene PubMed Count 25
Grant Count 10
R01 Count 8
Funding $908,818.92
PubMed Score 43.90
PubTator Score 35.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (16)

PMID Text
25453051 These findings highlight the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expression
24239460 Data indicate that six transmembrane epithelial antigen of the prostate 1 (STEAP1) is consistently overexpressed in malignant prostate tissue, namely adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions.
24025158 The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients.
23060075 STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate.
22317770 A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane.
22317770 STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics.
22080479 STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, an unanticipated oncogenic function of STEAP1.
22080479 EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells.
21928126 Studies suggest that activated human gammadelta T cells can efficiently present PRAME and STEAP1-derived epitopes and allow breaking tolerance against these tumor-associated self-antigens.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQ      1 - 70
WHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQ     71 - 140
LHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIE    141 - 210
HDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDI    211 - 280
KQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL               281 - 339
//

Text Mined References (26)

PMID Year Title
25453051 2014 Annotating STEAP1 regulation in prostate cancer with 89Zr immuno-PET.
24239460 2014 STEAP1 is overexpressed in prostate cancer and prostatic intraepithelial neoplasia lesions, and it is positively associated with Gleason score.
24025158 2013 STEAP1 protein overexpression is an independent marker for biochemical recurrence in prostate carcinoma.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23060075 2013 Six transmembrane epithelial antigen of the prostate 1 is down-regulated by sex hormones in prostate cells.
22317770 2012 High STEAP1 expression is associated with improved outcome of Ewing's sarcoma patients.
22080479 2012 STEAP1 is associated with the invasive and oxidative stress phenotype of Ewing tumors.
21928126 2012 Activated human ?? T cells induce peptide-specific CD8+ T-cell responses to tumor-associated self-antigens.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19946888 2010 Defining the membrane proteome of NK cells.
More...