Property Summary

NCBI Gene PubMed Count 26
PubMed Score 46.19
PubTator Score 35.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.100 9.8e-03
Atopic dermatitis -1.300 2.7e-03
atypical teratoid / rhabdoid tumor 1.400 8.6e-03
cystic fibrosis 4.068 2.4e-08
ductal carcinoma in situ -1.100 2.9e-02
ependymoma -1.400 8.6e-03
esophageal adenocarcinoma 1.200 4.6e-02
gastric carcinoma 2.400 4.6e-02
glioblastoma 1.600 2.0e-05
intraductal papillary-mucinous adenoma (... 1.800 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.800 1.4e-02
lung adenocarcinoma 1.500 2.3e-10
malignant mesothelioma -6.100 1.1e-09
non-small cell lung cancer 2.293 1.7e-15
oligodendroglioma -1.200 7.2e-03
osteosarcoma 2.457 1.7e-03
ovarian cancer -1.300 3.3e-02
pancreatic cancer 1.300 1.4e-03
pediatric high grade glioma 1.900 3.3e-04

Gene RIF (17)

AA Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQ      1 - 70
WHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQ     71 - 140
LHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIE    141 - 210
HDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDI    211 - 280
KQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL               281 - 339
//

Text Mined References (27)

PMID Year Title