Property Summary

NCBI Gene PubMed Count 25
PubMed Score 43.90
PubTator Score 35.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.67843486051011E-15
malignant mesothelioma 3163 1.08726931346634E-9
cystic fibrosis 1670 2.41584574516638E-8
atypical teratoid/rhabdoid tumor 1095 1.519482848646E-4
ovarian cancer 8492 2.85818723485583E-4
pediatric high grade glioma 2712 3.2520669371185E-4
lung adenocarcinoma 2714 4.61333964881813E-4
pancreatic cancer 2300 0.00143430894017172
osteosarcoma 7933 0.0016603455800808
glioblastoma 5572 0.00263525898559248
Atopic dermatitis 944 0.00270049452806986
oligodendroglioma 2849 0.00720522576587169
ependymoma 2514 0.00862502440163674
astrocytic glioma 2241 0.00981703673481793
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0138222758295268
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0187680894603655
ductal carcinoma in situ 1745 0.0287064177888253
esophageal adenocarcinoma 737 0.0460380067869023
gastric carcinoma 832 0.0461075978279514
Disease Target Count Z-score Confidence
Prostate cancer 172 3.887 1.9
Ewing sarcoma 27 3.543 1.8

Expression

  Differential Expression (19)

Synonym

Accession Q9UHE8 A4D1E0 O95034
Symbols STEAP
PRSS24

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG

Gene RIF (16)

PMID Text
25453051 These findings highlight the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expression
24239460 Data indicate that six transmembrane epithelial antigen of the prostate 1 (STEAP1) is consistently overexpressed in malignant prostate tissue, namely adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions.
24025158 The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients.
23060075 STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate.
22317770 A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane.
22317770 STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics.
22080479 STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, an unanticipated oncogenic function of STEAP1.
22080479 EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells.
21928126 Studies suggest that activated human gammadelta T cells can efficiently present PRAME and STEAP1-derived epitopes and allow breaking tolerance against these tumor-associated self-antigens.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQ      1 - 70
WHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQ     71 - 140
LHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIE    141 - 210
HDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDI    211 - 280
KQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL               281 - 339
//

Text Mined References (26)

PMID Year Title
25453051 2014 Annotating STEAP1 regulation in prostate cancer with 89Zr immuno-PET.
24239460 2014 STEAP1 is overexpressed in prostate cancer and prostatic intraepithelial neoplasia lesions, and it is positively associated with Gleason score.
24025158 2013 STEAP1 protein overexpression is an independent marker for biochemical recurrence in prostate carcinoma.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23060075 2013 Six transmembrane epithelial antigen of the prostate 1 is down-regulated by sex hormones in prostate cells.
22317770 2012 High STEAP1 expression is associated with improved outcome of Ewing's sarcoma patients.
22080479 2012 STEAP1 is associated with the invasive and oxidative stress phenotype of Ewing tumors.
21928126 2012 Activated human ?? T cells induce peptide-specific CD8+ T-cell responses to tumor-associated self-antigens.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19946888 2010 Defining the membrane proteome of NK cells.
More...