Property Summary

NCBI Gene PubMed Count 22
PubMed Score 54.48
PubTator Score 33.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.0e-04
nephrosclerosis 333 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
nephrosclerosis -1.685 4.1e-02
psoriasis -1.400 1.0e-04

Gene RIF (8)

AA Sequence

MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISL      1 - 70
FPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLF     71 - 140
HLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVAL    141 - 210
HTVHFIYHLPSSKVGSL                                                         211 - 227
//

Text Mined References (23)

PMID Year Title