Property Summary

NCBI Gene PubMed Count 55
Grant Count 24
R01 Count 11
Funding $2,356,250.96
PubMed Score 75.04
PubTator Score 58.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Amyotrophic Lateral Sclerosis 1.115 0.000
hepatocellular carcinoma 1.100 0.019
pancreatic cancer 1.100 0.043
Multiple myeloma 1.735 0.003
astrocytic glioma -1.300 0.024
ependymoma -1.400 0.000
glioblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -2.700 0.000
lung cancer -1.200 0.035
sarcoidosis 1.200 0.004
adult high grade glioma -1.500 0.001
pancreatic carcinoma 1.100 0.043
ovarian cancer -2.000 0.000
dermatomyositis 1.600 0.003

Gene RIF (36)

PMID Text
26944018 These findings provide a molecular basis for the development of ALS/FTD-associated proteinopathy and establish novel therapeutic targets for ALS.
26303000 UBQLN2 is specifically expressed in the urine of urothelial carcinoma patients.
26141599 Results showed that UBQLN2 is selectively recruited to nuclear inclusions in Huntington's disease but not spinocerebellar ataxia type 3
26075709 Mutations in UBQLN2 gene cause dominant inheritance of amyotrophic lateral sclerosis due to Defective Proteasome Delivery.
25672654 UBQLN2 may be a new molecular target for chemotherapeutics and a useful clinicopathological marker in human osteosarcoma.
25616961 ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1
25398946 ALS-linked mutations in both OPTN and UBQLN2 interfere with the constitution of specific endosomal vesicles, suggesting that the vesicles are involved in protein homeostasis and that these proteins function in common pathological processes.
25246588 Data indicate cognitive deficits in mutant ubiquilin 2 protein UBQLN2P497H transgenic mice.
25179229 A single putative mutation of UBQLN2 in a cohort of patients with front temporal lobar degeneration was found.
24771548 As ubiquilin-2-positive inclusions are identified in brain, this mutant peptide predisposes to protein misfolding and accumulation.
More...

AA Sequence

MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTD      1 - 70
QLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNS     71 - 140
NPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQ    141 - 210
MQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPML    211 - 280
NAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNAT    281 - 350
GNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP    351 - 420
QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIG    421 - 490
PVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFI    491 - 560
QQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS          561 - 624
//

Text Mined References (64)

PMID Year Title
26944018 2016 Disturbance of proteasomal and autophagic protein degradation pathways by amyotrophic lateral sclerosis-linked mutations in ubiquilin 2.
26303000 2016 Ubiquilin2 as a novel marker for detection of urothelial carcinoma cells in urine.
26141599 2015 Differential recruitment of UBQLN2 to nuclear inclusions in the polyglutamine diseases HD and SCA3.
26075709 2015 Defective Proteasome Delivery of Polyubiquitinated Proteins by Ubiquilin-2 Proteins Containing ALS Mutations.
25672654 2015 Ubiquilin 2 enhances osteosarcoma progression through resistance to hypoxic stress.
25616961 2015 ALS-linked mutations in ubiquilin-2 or hnRNPA1 reduce interaction between ubiquilin-2 and hnRNPA1.
25398946 2015 Evidence of a link between ubiquilin 2 and optineurin in amyotrophic lateral sclerosis.
25246588 2014 Dendritic spinopathy in transgenic mice expressing ALS/dementia-linked mutant UBQLN2.
25179229 2015 UBQLN2 variant of unknown significance in frontotemporal lobar degeneration.
24811749 2014 Autoubiquitination of the 26S proteasome on Rpn13 regulates breakdown of ubiquitin conjugates.
More...