Property Summary

NCBI Gene PubMed Count 63
PubMed Score 82.07
PubTator Score 58.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Dementia 175 3.312 1.7
Lateral sclerosis 15 3.312 1.7

Expression

  Differential Expression (16)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.115 5.1e-05
adult high grade glioma -1.500 1.4e-03
astrocytic glioma -1.300 2.4e-02
atypical teratoid / rhabdoid tumor -2.100 4.7e-05
dermatomyositis 1.600 2.5e-03
ependymoma -1.300 3.0e-02
glioblastoma -1.200 1.0e-05
hepatocellular carcinoma 1.100 1.9e-02
lung cancer -1.200 3.5e-02
medulloblastoma -1.200 1.2e-04
medulloblastoma, large-cell -2.700 3.2e-05
Multiple myeloma 1.735 3.4e-03
ovarian cancer -2.000 3.8e-07
pancreatic cancer 1.100 4.3e-02
pancreatic carcinoma 1.100 4.3e-02
sarcoidosis 1.200 3.6e-03

Gene RIF (43)

AA Sequence

MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTD      1 - 70
QLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNS     71 - 140
NPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQ    141 - 210
MQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPML    211 - 280
NAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNAT    281 - 350
GNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP    351 - 420
QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIG    421 - 490
PVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFI    491 - 560
QQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS          561 - 624
//

Text Mined References (72)

PMID Year Title