Property Summary

NCBI Gene PubMed Count 84
Grant Count 63
R01 Count 32
Funding $8,260,732.43
PubMed Score 143.82
PubTator Score 135.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
psoriasis 2.500 0.000
osteosarcoma 1.009 0.016
glioblastoma 1.100 0.006
lung cancer 1.100 0.004
group 4 medulloblastoma 1.400 0.000
COPD -1.100 0.002
lung carcinoma -1.100 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q9UHD8 A8K2V3 B3KPM0 B4DTL9 B4E0N2 B4E274 B7Z654 Q96QF3 Q96QF4 Q96QF5 Q9HA04 Q9UG40 Q9Y5W4
Symbols MSF
MSF1
NAPB
SINT1
PNUTL4
SeptD1
AF17q25

Gene

PDB

4YQF   5CYO   5CYP  

Gene RIF (60)

PMID Text
26633373 SEPT9 promoter methylation and MN frequency, both measured in peripheral blood, occur at an early stage compared to carcinoma development, indicating that the approach might be suitable to monitor CRC development.
26471083 provide a full overview of the theoretical basis, development, validation, and clinical applications of the SEPT9 assay for both basic science researchers and clinical practitioners
25946211 KRAS mutations and SEPT9 promoter methylation were present in 34% (29/85) and in 82% (70/85) of primary tumor tissue samples.
25898316 SEPT9_i1 is expressed in high-grade prostate tumors suggesting it has a significant role in prostate tumorigenesis.
25526039 Results show that in plasma samples, elevated methylated SEPT9 (mSEPT9) values were detected in colorectal cancer, but not in adenomas. Tissue levels of mSEPT9 alone are not sufficient to predict mSEPT9 levels in plasma.
25472714 we demonstrate that SEPT9 negatively regulates EGFR degradation by preventing the association of the ubiquitin ligase Cbl with CIN85, resulting in reduced EGFR ubiquitylation
25293760 Authors report here that the septins SEPT2, -9, -11, and probably -7 form fibrillar structures around the chlamydial inclusion.
24633736 SEPT9 promoter methylation is detected in free circulating DNA of lung cancer patients
24535900 Our results suggest that SEPT9 gene methylation is a valuable biomarker for screening CRC in the Chinese population
24386354 prognostic value of SHOX2 and SEPT9 DNA methylation in benign, paramalignant and malignant pleural effusions
More...

AA Sequence

MKKSYSGGTRTSSGRLRRLGDSSGPALKRSFEVEEVETPNSTPPRRVQTPLLRATVASSTQKFQDLGVKN      1 - 70
SEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGH     71 - 140
KTPEPAPRRTEITIVKPQESAHRRMEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLEN    141 - 210
SEPAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVG    211 - 280
IDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIE    281 - 350
EKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGH    351 - 420
SLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEK    421 - 490
FREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLRDLLIRTHMQNIKDITSSIHFEAY    491 - 560
RVKRLNEGSSAMANGMEEKEPEAPEM                                                561 - 586
//

Text Mined References (98)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26633373 2015 Simultaneous Analysis of SEPT9 Promoter Methylation Status, Micronuclei Frequency, and Folate-Related Gene Polymorphisms: The Potential for a Novel Blood-Based Colorectal Cancer Biomarker.
26471083 2015 SEPT9: A Specific Circulating Biomarker for Colorectal Cancer.
25946211 2015 Comparison of genetic and epigenetic alterations of primary tumors and matched plasma samples in patients with colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25898316 2015 High SEPT9_i1 protein expression is associated with high-grade prostate cancers.
25526039 2014 Detection of methylated septin 9 in tissue and plasma of colorectal patients with neoplasia and the relationship to the amount of circulating cell-free DNA.
25472714 2015 SEPT9 negatively regulates ubiquitin-dependent downregulation of EGFR.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
More...