Property Summary

NCBI Gene PubMed Count 90
PubMed Score 161.90
PubTator Score 135.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
lung carcinoma 2843 7.4e-18
ovarian cancer 8520 7.8e-07
malignant mesothelioma 3232 3.0e-06
psoriasis 6694 1.8e-05
group 4 medulloblastoma 1855 1.5e-04
COPD 118 2.2e-03
lung cancer 4740 3.7e-03
glioblastoma 5792 5.7e-03
osteosarcoma 7950 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Amyotrophic neuralgia 13 0.0 5.0
Disease Target Count Z-score Confidence
Brachial plexus neuropathy 6 6.553 3.3
Cancer 2499 3.922 2.0
Adenoma 167 3.006 1.5
Disease Target Count
AMYOTROPHY, HEREDITARY NEURALGIC 1

Expression

  Differential Expression (9)

Disease log2 FC p
COPD -1.100 2.2e-03
glioblastoma 1.100 5.7e-03
group 4 medulloblastoma 1.400 1.5e-04
lung cancer 1.100 3.7e-03
lung carcinoma -1.100 7.4e-18
malignant mesothelioma -1.100 3.0e-06
osteosarcoma 1.009 1.6e-02
ovarian cancer 1.200 7.8e-07
psoriasis 2.500 1.8e-05

 OMIM Phenotype (1)

Gene RIF (66)

AA Sequence

MKKSYSGGTRTSSGRLRRLGDSSGPALKRSFEVEEVETPNSTPPRRVQTPLLRATVASSTQKFQDLGVKN      1 - 70
SEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGH     71 - 140
KTPEPAPRRTEITIVKPQESAHRRMEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLEN    141 - 210
SEPAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVG    211 - 280
IDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIE    281 - 350
EKGVRMKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGH    351 - 420
SLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEK    421 - 490
FREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLRDLLIRTHMQNIKDITSSIHFEAY    491 - 560
RVKRLNEGSSAMANGMEEKEPEAPEM                                                561 - 586
//

Text Mined References (104)

PMID Year Title