Property Summary

NCBI Gene PubMed Count 19
PubMed Score 20.79
PubTator Score 18.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 3.664929233525E-5
malignant mesothelioma 3163 6.68925042681522E-5
osteosarcoma 7933 5.17589875338842E-4
nephrosclerosis 329 0.00605602478804296
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00714256671024796
Rheumatoid Arthritis 1171 0.0166772062731192

Synonym

Accession Q9UHD4 D3DS73 Q546V8 Q9NNW9
Symbols

Gene

PDB

1D4B  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (8)

PMID Text
26865724 CIDEB downregulation may contribute to HCV-induced hepatic steatosis
24980280 CIDEB can act as an anti-HCV host factor and contribute to altered triglyceride homeostasis.
24829338 Authors found CIDEB to be an essential cofactor for hepatitis C virus entry into hepatocytes.
24161736 this work highlights CIDEB's role in lipid droplet (LD) fusion, and presents a new model system to study the PGC-1alpha/CIDEB pathway's role in LD dynamics and the VLDL pathway.
23475172 CIDE proteins expression correlate with tumor and survival characteristics in patients with renal cell carcinoma.
20551328 PGC-1alpha plays an important role in partitioning cytoplasmic TG toward the VLDL secretory compartments and promoting VLDL secretion via transcriptional induction of CideB.
19064571 Observational study of gene-disease association. (HuGE Navigator)
16248853 A novel mechanism for the cell-specific transcription of the human CIDE-B gene, which involves epigenetic and genetic control at separate respective promoters is reported.

AA Sequence

MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLN      1 - 70
GVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYK     71 - 140
QNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQW    141 - 210
QQKGRLHSY                                                                 211 - 219
//

Text Mined References (19)

PMID Year Title
26865724 2016 Hepatitis C Virus-Induced Degradation of Cell Death-Inducing DFFA-Like Effector B Leads to Hepatic Lipid Dysregulation.
24980280 2014 Investigating the antiviral role of cell death-inducing DFF45-like effector B in HCV replication.
24829338 2014 Cell death-inducing DFFA-like effector b is required for hepatitis C virus entry into hepatocytes.
24571439 2014 Genome-wide association analyses of child genotype effects and parent-of-origin effects in specific language impairment.
24161736 2013 Human serum activates CIDEB-mediated lipid droplet enlargement in hepatoma cells.
23475172 2013 Expression of CIDE proteins in clear cell renal cell carcinoma and their prognostic significance.
20551328 2010 Peroxisome proliferator-activated receptor-gamma coactivator-1alpha (PGC-1alpha) stimulates VLDL assembly through activation of cell death-inducing DFFA-like effector B (CideB).
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...