Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.59
PubTator Score 18.12

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.600 6.7e-05
nephrosclerosis -1.007 6.1e-03
osteosarcoma -1.785 5.2e-04
pancreatic ductal adenocarcinoma liver m... -2.633 7.1e-03
Rheumatoid arthritis -1.300 1.7e-02
tuberculosis 1.200 3.7e-05

Gene RIF (10)

AA Sequence

MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLN      1 - 70
GVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYK     71 - 140
QNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQW    141 - 210
QQKGRLHSY                                                                 211 - 219
//

Text Mined References (21)

PMID Year Title