Property Summary

NCBI Gene PubMed Count 19
Grant Count 2
Funding $200,827
PubMed Score 20.79
PubTator Score 18.12

Knowledge Summary

Patent

No data available

Gene RIF (8)

PMID Text
26865724 CIDEB downregulation may contribute to HCV-induced hepatic steatosis
24980280 CIDEB can act as an anti-HCV host factor and contribute to altered triglyceride homeostasis.
24829338 Authors found CIDEB to be an essential cofactor for hepatitis C virus entry into hepatocytes.
24161736 this work highlights CIDEB's role in lipid droplet (LD) fusion, and presents a new model system to study the PGC-1alpha/CIDEB pathway's role in LD dynamics and the VLDL pathway.
23475172 CIDE proteins expression correlate with tumor and survival characteristics in patients with renal cell carcinoma.
20551328 PGC-1alpha plays an important role in partitioning cytoplasmic TG toward the VLDL secretory compartments and promoting VLDL secretion via transcriptional induction of CideB.
19064571 Observational study of gene-disease association. (HuGE Navigator)
16248853 A novel mechanism for the cell-specific transcription of the human CIDE-B gene, which involves epigenetic and genetic control at separate respective promoters is reported.

AA Sequence

MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLN      1 - 70
GVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYK     71 - 140
QNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQW    141 - 210
QQKGRLHSY                                                                 211 - 219
//

Text Mined References (19)

PMID Year Title
26865724 2016 Hepatitis C Virus-Induced Degradation of Cell Death-Inducing DFFA-Like Effector B Leads to Hepatic Lipid Dysregulation.
24980280 2014 Investigating the antiviral role of cell death-inducing DFF45-like effector B in HCV replication.
24829338 2014 Cell death-inducing DFFA-like effector b is required for hepatitis C virus entry into hepatocytes.
24571439 2014 Genome-wide association analyses of child genotype effects and parent-of-origin effects in specific language impairment.
24161736 2013 Human serum activates CIDEB-mediated lipid droplet enlargement in hepatoma cells.
23475172 2013 Expression of CIDE proteins in clear cell renal cell carcinoma and their prognostic significance.
20551328 2010 Peroxisome proliferator-activated receptor-gamma coactivator-1alpha (PGC-1alpha) stimulates VLDL assembly through activation of cell death-inducing DFFA-like effector B (CideB).
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...