Property Summary

NCBI Gene PubMed Count 142
Grant Count 295
R01 Count 168
Funding $33,252,825.07
PubMed Score 447.86
PubTator Score 340.02

Knowledge Summary

Patent (19,375)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q9UHD2 A8K4S4 Q8IYV3 Q9NUJ5
Symbols NAK
T2K
FTDALS4

Gene

PDB

4EFO   4EUT   4EUU   4IM0   4IM2   4IM3   4IW0   4IWO   4IWP   4IWQ  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (100)

PMID Text
26674655 TBK1 carriers with amyotrophic lateral sclerosis had shorter disease duration than carriers with frontotemporal dementia in a Belgian cohort.
26656453 The expression of TBK1 in mammalian cell mitosis is reported, including localization of the protein during division and its binding properties.
26581300 TBK1 loss of function mutations are the third most frequent cause of clinical frontotemporal dementia in a Belgian cohort.
26476236 TBK1 should thus also be sequenced, after exclusion of C9orf72 mutation, in patients presenting frontotemporal dementia, particularly in cases secondarily associated with amyotrophic lateral sclerosis
26350399 Its frame-shift mutation results in familial amyotrophic lateral sclerosis of Chinese origin.
25972374 Optineurin and TANK-binding kinase 1 (TBK1) are transiently recruited to the polyubiquitinated mitochondria, and the activated TBK1 phosphorylates p62 at S403
25943890 Loss-of-function variants in OPTN and TBK1 are associated with clinical and pathological frontotemporal dementia without motor neuron disease; TBK1 mutations are common cause of frontotemporal lobar degeneration with TAR DNA-binding protein 43 inclusions
25939384 Data indicate that suppressor of cytokine signaling 3 (SOCS3) knockdown markedly increases the abundance of TANK-binding kinase 1 (TBK1).
25923723 Data suggest OPTN (optineurin) is involved in up-regulation of innate immunity in mitosis; mechanism involves phosphorylation/mitochondrial translocation of TBK1 and phosphorylation/nuclear translocation of CYLD (cylindromatosis protein).
25855743 HIV-1 Vpr and Vif were shown to bind to TBK1 and inhibit its autophosphorylation by binding of these proteins leading to a block in type I and III interferon induction.
More...

AA Sequence

MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKL      1 - 70
FAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGN     71 - 140
IMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVT    141 - 210
FYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPV    211 - 280
LANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQ    281 - 350
ELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITG    351 - 420
VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINL    421 - 490
EAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMT    491 - 560
EIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQL    561 - 630
LSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGV    631 - 700
VKELAENNHILERFGSLTMDGGLRNVDCL                                             701 - 729
//

Text Mined References (158)

PMID Year Title
26674655 2016 Clinical features of TBK1 carriers compared with C9orf72, GRN and non-mutation carriers in a Belgian cohort.
26656453 2015 Tank binding kinase 1 is a centrosome-associated kinase necessary for microtubule dynamics and mitosis.
26581300 2015 Loss of TBK1 is a frequent cause of frontotemporal dementia in a Belgian cohort.
26476236 2015 TBK1 mutation frequencies in French frontotemporal dementia and amyotrophic lateral sclerosis cohorts.
26350399 2015 Novel TBK1 truncating mutation in a familial amyotrophic lateral sclerosis patient of Chinese origin.
25972374 2015 TBK1 controls autophagosomal engulfment of polyubiquitinated mitochondria through p62/SQSTM1 phosphorylation.
25943890 2015 Whole-genome sequencing reveals important role for TBK1 and OPTN mutations in frontotemporal lobar degeneration without motor neuron disease.
25939384 2015 SOCS3 Drives Proteasomal Degradation of TBK1 and Negatively Regulates Antiviral Innate Immunity.
25923723 2015 Optineurin regulates the interferon response in a cell cycle-dependent manner.
25855743 2015 HIV Blocks Interferon Induction in Human Dendritic Cells and Macrophages by Dysregulation of TBK1.
More...