Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.15
PubTator Score 4.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.2e-04
group 3 medulloblastoma 4104 1.2e-03
oligodendroglioma 2850 1.4e-03
astrocytic glioma 2597 2.2e-03
ependymoma 4679 2.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.400 2.2e-03
ependymoma -1.500 2.9e-03
group 3 medulloblastoma -1.300 1.2e-03
oligodendroglioma -1.400 1.4e-03
osteosarcoma -1.133 1.2e-04

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPP      1 - 70
EPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNE     71 - 140
ENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEG    141 - 210
CTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNV    211 - 280
KLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPAAKKQEKQKDATTD                      281 - 332
//

Text Mined References (27)

PMID Year Title