Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.03
PubTator Score 4.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.400 0.002
ependymoma -1.500 0.003
oligodendroglioma -1.400 0.001
osteosarcoma -1.133 0.000
group 3 medulloblastoma -1.300 0.001

Gene RIF (8)

PMID Text
25342750 suppression of miR-26b expression up-regulates its target gene CHORDC1, which increases HBV enhancer/promoter activities and promotes viral transcription, gene expression, and replication
24615293 morgana causes PTEN destabilization, by inhibiting ROCK activity
23184943 Chp-1 and melusin can interact with cochaperones PP5 and Sgt1 and with each other in an ATP-dependent manner
22190034 HIV-1 Vpu is identified to have a physical interaction with cysteine and histidine-rich domain containing 1 (CHORDC1; CHP1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20800603 Observational study of gene-disease association. (HuGE Navigator)
19875381 A novel ADP-dependent HSP90 interaction with the cysteine- and histidine-rich domain (CHORD)-containing protein CHORDC1, is characterized.
18854154 Knockdown of cysteine and histidine-rich domain (CHORD) containing 1 (CHORDC1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
10571178 This paper described the cloning of a barley CHORD containing protein, but it also described the CHORD containing proteins in other species including human and characterized the CHORD domains.

AA Sequence

MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPP      1 - 70
EPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNE     71 - 140
ENKKEEDNDEIKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEG    141 - 210
CTKGKHMWTKKDAGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNV    211 - 280
KLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASLELPAAKKQEKQKDATTD                      281 - 332
//

Text Mined References (27)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25342750 2014 MicroRNA-26b inhibits hepatitis B virus transcription and replication by targeting the host factor CHORDC1 protein.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24615293 2014 Morgana acts as a proto-oncogene through inhibition of a ROCK-PTEN pathway.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184943 2013 Dynamic nucleotide-dependent interactions of cysteine- and histidine-rich domain (CHORD)-containing Hsp90 cochaperones Chp-1 and melusin with cochaperones PP5 and Sgt1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...