Property Summary

NCBI Gene PubMed Count 76
Grant Count 29
R01 Count 19
Funding $3,072,844.68
PubMed Score 98.18
PubTator Score 100.60

Knowledge Summary

Patent

No data available

Gene RIF (66)

PMID Text
26522365 The level of IL-19 in the peripheral blood of allergic rhinitis(AR) patients increased and was related with the clinical severity of AR.
26486636 This study demonstrated that IL-19 and IL-24 are associated with the modulation of T-cell responses in filarial infections.
26404542 Data show reduced cytokines IL-10 and IL-19 expression, and enhanced IL-20 and il-1 beta expression in chronic recurrent multifocal osteomyelitis (CRMO) monocytes.
25639337 These findings indicate that IL-19 production is diminished in SpA. Taken together, impaired IL-19 control of the innate immune system might be involved in the pathogenesis of SpA.
25633979 these findings suggest that molecular features at the IL19 locus may modestly alter the establishment of HIV-1 infection.
25178435 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different
25046339 IL-19 as a component of the IL-23/IL-17 axis strengthens the IL-17A action and might be a biomarker for the activity of this axis in chronic inflammatory disorders
24943510 we delineate the detailed molecular pathway for IL-4 up-regulation of IL-19 in keratinocytes, which may play an important role in AD pathogenesis.
24919552 It supresses inflammation and its gene deletion causes inflammatory bowel disease.(review)
24819332 IL-19 rs2243188 SNP was associated with the susceptibility to lupus nephritis in a Chinese population; but the minor C allele of SNP rs2243188 might be a protective factor for systemic lupus erythematosus
More...

AA Sequence

MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIK      1 - 70
PLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVI     71 - 140
HDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA                                     141 - 177
//

Text Mined References (76)

PMID Year Title
26522365 2015 [Increased IL-19 level in peripheral blood of patients with allergic rhinitis is related with clinical severity].
26486636 2016 Modulation of CD4+ and CD8+ T-Cell Function by Interleukin 19 and Interleukin 24 During Filarial Infections.
26404542 2015 Altered expression of IL-10 family cytokines in monocytes from CRMO patients result in enhanced IL-1? expression and release.
25639337 2015 Toll-like receptor 2 and 4 induced interleukin-19 dampens immune reactions and associates inversely with spondyloarthritis disease activity.
25633979 Immunogenetic influences on acquisition of HIV-1 infection: consensus findings from two African cohorts point to an enhancer element in IL19 (1q32.2).
25178435 2015 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different contribution to systemic and joint inflammation.
25046339 2014 IL-19 is a component of the pathogenetic IL-23/IL-17 cascade in psoriasis.
24943510 2014 Interleukin-4 up-regulation of epidermal interleukin-19 expression in keratinocytes involves the binding of signal transducer and activator of transcription 6 (Stat6) to the imperfect Stat6 sites.
24919552 2014 [Emerging role of interleukin-19 as an inflammatory mediator in inflammatory bowel disease].
24819332 2014 Association study of interleukin-19 rs2243188 polymorphism with systemic lupus erythematosus in a Chinese population.
More...