Property Summary

NCBI Gene PubMed Count 82
PubMed Score 102.32
PubTator Score 100.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.500 3.4e-04
ileal Crohn's disease 1.911 4.3e-02
tuberculosis -1.200 4.4e-06

Gene RIF (72)

AA Sequence

MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIK      1 - 70
PLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVI     71 - 140
HDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA                                     141 - 177
//

Text Mined References (82)

PMID Year Title