Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
Funding $312,400
PubMed Score 15.44
PubTator Score 13.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.800 0.000
astrocytic glioma -1.600 0.023
ependymoma -2.000 0.039
oligodendroglioma -1.200 0.045
psoriasis -1.200 0.001
osteosarcoma -2.119 0.001
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.300 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -2.400 0.000
lung cancer 1.500 0.000
adult high grade glioma -1.100 0.001
subependymal giant cell astrocytoma -1.558 0.026
ulcerative colitis -1.100 0.000
ovarian cancer 1.500 0.003
dermatomyositis 1.300 0.004

Gene RIF (8)

PMID Text
26817873 In combination testing, MKRN1 + HPV showed the highest sensitivity and specificity levels. The MKRN1 biomarker may be a useful adjunct in primary cervical cytology screening.
26183061 EGFR/PI3K/AKT-mediated ubiquitination and degradation of PTEN are dependent on the MKRN1 E3 ligase.
23104211 Results verified MKRN1 as an ubiquitin E3 ligase of p14ARF, it potentially regulates cellular aging and tumorigenesis in gastric cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19846531 MKRN1 could induce WNV capsid protein ubiquitination and degradation in a proteasome-dependent manner
19604354 Makorin 1 is a novel SEREX antigen of esophageal squamous cell carcinoma
19536131 Data indicate that MKRN1 is a novel modulator of p53 and p21, preferentially leading cells to p53-dependent apoptosis by suppressing p21.
16785614 MKRN1 may represent a nuclear protein with multiple nuclear functions, including regulating RNA polymerase II-catalyzed transcription.

AA Sequence

MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCK      1 - 70
EGDNCRYSHDLSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGP     71 - 140
LVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPLQGSVTKEESEKEQTAVETK    141 - 210
KQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMV    211 - 280
CGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEE    281 - 350
KEEKQKLILKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW    351 - 420
ELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLDL            421 - 482
//

Text Mined References (24)

PMID Year Title
26817873 2016 Makorin Ring Finger Protein 1 as Adjunctive Marker in Liquid-based Cervical Cytology.
26183061 2015 PI3K/AKT activation induces PTEN ubiquitination and destabilization accelerating tumourigenesis.
23104211 2012 Acceleration of gastric tumorigenesis through MKRN1-mediated posttranslational regulation of p14ARF.
22864571 2012 Ubiquitination and degradation of the FADD adaptor protein regulate death receptor-mediated apoptosis and necroptosis.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21172006 2010 The vertebrate makorin ubiquitin ligase gene family has been shaped by large-scale duplication and retroposition from an ancestral gonad-specific, maternal-effect gene.
20473778 2010 Differentiation linked regulation of telomerase activity by Makorin-1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19846531 2010 MKRN1 induces degradation of West Nile virus capsid protein by functioning as an E3 ligase.
19604354 2009 Identification of Makorin 1 as a novel SEREX antigen of esophageal squamous cell carcinoma.
More...