Property Summary

NCBI Gene PubMed Count 20
PubMed Score 16.38
PubTator Score 13.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 1.0e-03
astrocytic glioma -1.600 2.3e-02
atypical teratoid / rhabdoid tumor -1.700 2.4e-06
dermatomyositis 1.100 2.1e-04
ependymoma -2.000 3.9e-02
glioblastoma -1.300 8.1e-06
lung cancer 1.500 6.4e-05
medulloblastoma -1.100 2.2e-06
medulloblastoma, large-cell -2.400 8.3e-06
Multiple myeloma 1.800 3.4e-04
oligodendroglioma -1.200 4.5e-02
osteosarcoma -2.119 9.8e-04
ovarian cancer 1.500 2.6e-03
psoriasis -1.200 5.6e-04
subependymal giant cell astrocytoma -1.558 2.6e-02
ulcerative colitis -1.100 5.5e-09

 MGI Phenotype (1)

Gene RIF (8)

AA Sequence

MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCK      1 - 70
EGDNCRYSHDLSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGP     71 - 140
LVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPLQGSVTKEESEKEQTAVETK    141 - 210
KQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMV    211 - 280
CGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEE    281 - 350
KEEKQKLILKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW    351 - 420
ELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLDL            421 - 482
//

Text Mined References (24)

PMID Year Title