Property Summary

Ligand Count 42
NCBI Gene PubMed Count 36
PubMed Score 195.84
PubTator Score 80.33

Knowledge Summary

Patent (7,802)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 1.2e-05

Gene RIF (24)

AA Sequence

MKPTSGPEEARRPASDIRVFASNCSMHGLGHVFGPGSLSLRRGMWAAAVVLSVATFLYQVAERVRYYREF      1 - 70
HHQTALDERESHRLIFPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPAEHAAFLRALGRPPAPPGFMP     71 - 140
SPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIFTRMGKCYTFNSGADGAELLTTTRGGMGNGL    141 - 210
DIMLDVQQEEYLPVWRDNEETPFEVGIRVQIHSQEEPPIIDQLGLGVSPGYQTFVSCQQQQLSFLPPPWG    211 - 280
DCSSASLNPNYEPEPSDPLGSPSPSPSPPYTLMGCRLACETRYVARKCGCRMVYMPGDVPVCSPQQYKNC    281 - 350
AHPAIDAMLRKDSCACPNPCASTRYAKELSMVRIPSRAAARFLARKLNRSEAYIAENVLALDIFFEALNY    351 - 420
ETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQRHSSTNLLQEG    421 - 490
LGSHRTQVPHLSLGPRPPTPPCAVTKTLSASHRTCYLVTQL                                 491 - 531
//

Text Mined References (37)

PMID Year Title