Property Summary

NCBI Gene PubMed Count 33
PubMed Score 172.15
PubTator Score 80.33

Knowledge Summary

Patent (7,802)



  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 0.000


Accession Q9UHC3 B2R9V0 O60263 O75906 Q59FN9 Q9UER8 Q9UHC4 ASIC3
Symbols ACCN3


PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Platypus OMA Inparanoid

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
743250 screening 1 / 0 / 0 Discovery and characterization of a small molecule allosteric agonists of mas-related G-Protein coupled receptor X1 ( MrgX1)
743251 screening 1 / 0 / 0 Development of a novel orthosteric Muscarinic 5 (M5) antagonist possessing a hig degree of muscarinic subtype selectivity
743252 screening 1 / 0 / 0 Development of the first CNS penetrant Muscarinic 5 (M5) Positive Allosteric Modulator based on a novel non-isatin core
743435 other 0 / 0 / 0 Development of inhibitors for Dopamine D4 Receptors: Eurofin Panel Assay Results
743437 other 0 / 0 / 0 Development of inhibitors for PLD2 (Eurofin Panel Assay Results)

Gene RIF (22)

26772186 These findings open new perspectives on the roles of ASIC3 in the absence of tissue pH variation, as well as on the contribution of those channels to lipid-mediated signaling.
26033064 This study suggests that ASIC23may play a role as mediators of inflammatory pain and be involved in the pathogenesis of frozen shoulder.
25476599 Blocking ASIC3 in interneurons from temporal lobe epilepsy patients decreased the frequency of action potential firing.
23801332 Sea anemone peptide with uncommon beta-hairpin structure inhibits acid-sensing ion channel 3 (ASIC3) and reveals analgesic activity.
22854960 Lignan from thyme possesses inhibitory effect on ASIC3 channel current.
22842475 Experiments with Asic3 inhibitors show that Asic3 inhibition leads to loss of pressure-induced vasodilation due to pressure detection failure rather than endothelial mechanisms.
22829666 ASIC3 is able to sense the extracellular pH in both directions and to dynamically adapt its activity between pH 5.0 and 8.0, playing a role in fine tuning neuronal membrane potentials and neuron sensitization in various pH environments.
22809504 CAR and ASIC3 co-immunoprecipitate only when co-expressed with PSD-95.
22778854 The highly proton sensitive ASIC3 channels are predominantly distributed in peripheral sensory neurons, correlating with their roles in multimodal sensory perception, including nociception, mechanosensation, and chemosensation.
22702502 A mechanism of induction of ASIC-3 expression relevant to AR was suggested by the finding that eosinophil peroxidase (EPO), acting via ERK1/2, induced the expression of ASIC-3 in epithelial cells.

AA Sequence

LGSHRTQVPHLSLGPRPPTPPCAVTKTLSASHRTCYLVTQL                                 491 - 531

Text Mined References (34)

PMID Year Title
26772186 2016 Non-acidic activation of pain-related Acid-Sensing Ion Channel 3 by lipids.
26033064 2015 Up-regulation of acid-sensing ion channels in the capsule of the joint in frozen shoulder.
25476599 2016 Elevated Expression of Acid-Sensing Ion Channel 3 Inhibits Epilepsy via Activation of Interneurons.
24206072 2013 The potential role of transient receptor potential type A1 as a mechanoreceptor in human periodontal ligament cells.
23801332 2013 Sea anemone peptide with uncommon ?-hairpin structure inhibits acid-sensing ion channel 3 (ASIC3) and reveals analgesic activity.
22854960 2012 Lignan from thyme possesses inhibitory effect on ASIC3 channel current.
22842475 2012 Asic3 is a neuronal mechanosensor for pressure-induced vasodilation that protects against pressure ulcers.
22829666 2012 Human ASIC3 channel dynamically adapts its activity to sense the extracellular pH in both acidic and alkaline directions.
22809504 2012 Coxsackievirus and adenovirus receptor (CAR) mediates trafficking of acid sensing ion channel 3 (ASIC3) via PSD-95.
22778854 2011 ASIC3 channels in multimodal sensory perception.