Property Summary

NCBI Gene PubMed Count 42
Grant Count 87
R01 Count 73
Funding $12,196,133.61
PubMed Score 60.48
PubTator Score 40.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.800 0.004
hepatocellular carcinoma 1.700 0.000
pancreatic cancer 2.600 0.000
psoriasis -1.300 0.001
pancreatic carcinoma 2.600 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q9UHC1 P49751 Q56DK9 Q9P292 Q9UHC0
Symbols HNPCC7

Gene

Gene RIF (31)

PMID Text
26520453 A polymorphism within the MLH3 gene is associated with oligozoospermia in Caucasian men of a certain area.
26303387 MutL homolog 3 (MLH3) promoter methylation was observed in 61% of oligoastrocytoma and 27% of astrocytoma.
24759751 Results indicate that CT(844)-CC(942) was associated with a high risk of cervical carcinoma and cervical intraepithelial neoplasia, and the CC(844)-CT(942) decreased the risk.
23696135 The experiments show recruitment and persistence of MutLgamma-heterodimers at UVA-induced DNA lesions.
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20154325 the MutSbeta-MutLalpha interaction is mediated in part by residues ((L/I)SRFF) embedded within the MSH3 PCNA-binding motif
19808033 There is an association of polymorphism C85T in MSH5 or C2531T in MLH3 with male infertility, specifically azoospermia or severe oligozoospermia, and interaction between these MSH5 and MLH3 polymorphisms increased the risk of developing male infertility
19808033 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MIKCLSVEVQAKLRSGLAISSLGQCVEELALNSIDAEAKCVAVRVNMETFQVQVIDNGFGMGSDDVEKVG      1 - 70
NRYFTSKCHSVQDLENPRFYGFRGEALANIADMASAVEISSKKNRTMKTFVKLFQSGKALKACEADVTRA     71 - 140
SAGTTVTVYNLFYQLPVRRKCMDPRLEFEKVRQRIEALSLMHPSISFSLRNDVSGSMVLQLPKTKDVCSR    141 - 210
FCQIYGLGKSQKLREISFKYKEFELSGYISSEAHYNKNMQFLFVNKRLVLRTKLHKLIDFLLRKESIICK    211 - 280
PKNGPTSRQMNSSLRHRSTPELYGIYVINVQCQFCEYDVCMEPAKTLIEFQNWDTLLFCIQEGVKMFLKQ    281 - 350
EKLFVELSGEDIKEFSEDNGFSLFDATLQKRVTSDERSNFQEACNNILDSYEMFNLQSKAVKRKTTAENV    351 - 420
NTQSSRDSEATRKNTNDAFLYIYESGGPGHSKMTEPSLQNKDSSCSESKMLEQETIVASEAGENEKHKKS    421 - 490
FLEHSSLENPCGTSLEMFLSPFQTPCHFEESGQDLEIWKESTTVNGMAANILKNNRIQNQPKRFKDATEV    491 - 560
GCQPLPFATTLWGVHSAQTEKEKKKESSNCGRRNVFSYGRVKLCSTGFITHVVQNEKTKSTETEHSFKNY    561 - 630
VRPGPTRAQETFGNRTRHSVETPDIKDLASTLSKESGQLPNKKNCRTNISYGLENEPTATYTMFSAFQEG    631 - 700
SKKSQTDCILSDTSPSFPWYRHVSNDSRKTDKLIGFSKPIVRKKLSLSSQLGSLEKFKRQYGKVENPLDT    701 - 770
EVEESNGVTTNLSLQVEPDILLKDKNRLENSDVCKITTMEHSDSDSSCQPASHILNSEKFPFSKDEDCLE    771 - 840
QQMPSLRESPMTLKELSLFNRKPLDLEKSSESLASKLSRLKGSERETQTMGMMSRFNELPNSDSSRKDSK    841 - 910
LCSVLTQDFCMLFNNKHEKTENGVIPTSDSATQDNSFNKNSKTHSNSNTTENCVISETPLVLPYNNSKVT    911 - 980
GKDSDVLIRASEQQIGSLDSPSGMLMNPVEDATGDQNGICFQSEESKARACSETEESNTCCSDWQRHFDV    981 - 1050
ALGRMVYVNKMTGLSTFIAPTEDIQAACTKDLTTVAVDVVLENGSQYRCQPFRSDLVLPFLPRARAERTV   1051 - 1120
MRQDNRDTVDDTVSSESLQSLFSEWDNPVFARYPEVAVDVSSGQAESLAVKIHNILYPYRFTKGMIHSMQ   1121 - 1190
VLQQVDNKFIACLMSTKTEENGEAGGNLLVLVDQHAAHERIRLEQLIIDSYEKQQAQGSGRKKLLSSTLI   1191 - 1260
PPLEITVTEEQRRLLWCYHKNLEDLGLEFVFPDTSDSLVLVGKVPLCFVEREANELRRGRSTVTKSIVEE   1261 - 1330
FIREQLELLQTTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQESCRLIEALSSCQLPFQCAHGRPSM   1331 - 1400
LPLADIDHLEQEKQIKPNLTKLRKMAQAWRLFGKAECDTRQSLQQSMPPCEPP                    1401 - 1453
//

Text Mined References (42)

PMID Year Title
26520453 2015 Single-nucleotide polymorphism rs 175080 in the MLH3 gene and its relation to male infertility.
26303387 2015 Genetic and epigenetic characterization of low-grade gliomas reveals frequent methylation of the MLH3 gene.
24759751 2014 Mismatch repair gene MLH3 Pro844Leu and Thr942Ile polymorphisms and the susceptibility to cervical carcinoma and HPV infection: a case-control study in a Chinese population.
23696135 2013 Stable expression of MutL? in human cells reveals no specific response to mismatched DNA, but distinct recruitment to damage sites.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
20603073 2010 A genetic screen identifies FAN1, a Fanconi anemia-associated nuclease necessary for DNA interstrand crosslink repair.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20437058 2010 The utility and predictive value of combinations of low penetrance genes for screening and risk prediction of colorectal cancer.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20154325 2010 MutLalpha and proliferating cell nuclear antigen share binding sites on MutSbeta.
More...