Property Summary

NCBI Gene PubMed Count 42
PubMed Score 64.51
PubTator Score 40.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 2.5e-05
hepatocellular carcinoma 547 3.7e-05
pancreatic cancer 2398 1.1e-04
pancreatic carcinoma 562 1.1e-04
psoriasis 6694 1.0e-03
gastric cancer 459 4.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Male infertility 206 3.253 1.6
Cancer 2499 3.21 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.800 4.0e-03
hepatocellular carcinoma 1.700 3.7e-05
ovarian cancer 1.400 2.5e-05
pancreatic cancer 2.600 1.1e-04
pancreatic carcinoma 2.600 1.1e-04
psoriasis -1.300 1.0e-03

Protein-protein Interaction (1)

Gene RIF (31)

AA Sequence

MIKCLSVEVQAKLRSGLAISSLGQCVEELALNSIDAEAKCVAVRVNMETFQVQVIDNGFGMGSDDVEKVG      1 - 70
NRYFTSKCHSVQDLENPRFYGFRGEALANIADMASAVEISSKKNRTMKTFVKLFQSGKALKACEADVTRA     71 - 140
SAGTTVTVYNLFYQLPVRRKCMDPRLEFEKVRQRIEALSLMHPSISFSLRNDVSGSMVLQLPKTKDVCSR    141 - 210
FCQIYGLGKSQKLREISFKYKEFELSGYISSEAHYNKNMQFLFVNKRLVLRTKLHKLIDFLLRKESIICK    211 - 280
PKNGPTSRQMNSSLRHRSTPELYGIYVINVQCQFCEYDVCMEPAKTLIEFQNWDTLLFCIQEGVKMFLKQ    281 - 350
EKLFVELSGEDIKEFSEDNGFSLFDATLQKRVTSDERSNFQEACNNILDSYEMFNLQSKAVKRKTTAENV    351 - 420
NTQSSRDSEATRKNTNDAFLYIYESGGPGHSKMTEPSLQNKDSSCSESKMLEQETIVASEAGENEKHKKS    421 - 490
FLEHSSLENPCGTSLEMFLSPFQTPCHFEESGQDLEIWKESTTVNGMAANILKNNRIQNQPKRFKDATEV    491 - 560
GCQPLPFATTLWGVHSAQTEKEKKKESSNCGRRNVFSYGRVKLCSTGFITHVVQNEKTKSTETEHSFKNY    561 - 630
VRPGPTRAQETFGNRTRHSVETPDIKDLASTLSKESGQLPNKKNCRTNISYGLENEPTATYTMFSAFQEG    631 - 700
SKKSQTDCILSDTSPSFPWYRHVSNDSRKTDKLIGFSKPIVRKKLSLSSQLGSLEKFKRQYGKVENPLDT    701 - 770
EVEESNGVTTNLSLQVEPDILLKDKNRLENSDVCKITTMEHSDSDSSCQPASHILNSEKFPFSKDEDCLE    771 - 840
QQMPSLRESPMTLKELSLFNRKPLDLEKSSESLASKLSRLKGSERETQTMGMMSRFNELPNSDSSRKDSK    841 - 910
LCSVLTQDFCMLFNNKHEKTENGVIPTSDSATQDNSFNKNSKTHSNSNTTENCVISETPLVLPYNNSKVT    911 - 980
GKDSDVLIRASEQQIGSLDSPSGMLMNPVEDATGDQNGICFQSEESKARACSETEESNTCCSDWQRHFDV    981 - 1050
ALGRMVYVNKMTGLSTFIAPTEDIQAACTKDLTTVAVDVVLENGSQYRCQPFRSDLVLPFLPRARAERTV   1051 - 1120
MRQDNRDTVDDTVSSESLQSLFSEWDNPVFARYPEVAVDVSSGQAESLAVKIHNILYPYRFTKGMIHSMQ   1121 - 1190
VLQQVDNKFIACLMSTKTEENGEAGGNLLVLVDQHAAHERIRLEQLIIDSYEKQQAQGSGRKKLLSSTLI   1191 - 1260
PPLEITVTEEQRRLLWCYHKNLEDLGLEFVFPDTSDSLVLVGKVPLCFVEREANELRRGRSTVTKSIVEE   1261 - 1330
FIREQLELLQTTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQESCRLIEALSSCQLPFQCAHGRPSM   1331 - 1400
LPLADIDHLEQEKQIKPNLTKLRKMAQAWRLFGKAECDTRQSLQQSMPPCEPP                    1401 - 1453
//

Text Mined References (42)

PMID Year Title