Property Summary

NCBI Gene PubMed Count 35
PubMed Score 23.60
PubTator Score 29.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.800 2.6e-03
Amyotrophic lateral sclerosis 1.071 2.1e-05
astrocytic glioma 1.300 8.8e-03
Astrocytoma, Pilocytic 2.100 2.5e-06
Barrett's esophagus 1.400 1.4e-02
esophageal adenocarcinoma 1.200 2.1e-02
gastric cancer 1.400 2.6e-02
glioblastoma 2.200 5.5e-09
interstitial cystitis -1.100 6.2e-04
intraductal papillary-mucinous adenoma (... 1.900 6.6e-03
intraductal papillary-mucinous carcinoma... 1.500 4.2e-02
intraductal papillary-mucinous neoplasm ... 2.400 2.1e-02
juvenile dermatomyositis 1.100 1.6e-09
lung cancer -1.600 2.1e-03
medulloblastoma, large-cell -1.500 3.8e-02
oligodendroglioma 1.700 3.4e-02
osteosarcoma 1.307 1.3e-02
ovarian cancer -2.600 9.8e-14
pancreatic cancer 1.200 1.5e-02
pancreatic ductal adenocarcinoma liver m... 1.410 2.0e-02
urothelial carcinoma -1.200 4.3e-02

Gene RIF (12)

AA Sequence

MESSPFNRRQWTSLSLRVTAKELSLVNKNKSSAIVEIFSKYQKAAEETNMEKKRSNTENLSQHFRKGTLT      1 - 70
VLKKKWENPGLGAESHTDSLRNSSTEIRHRADHPPAEVTSHAASGAKADQEEQIHPRSRLRSPPEALVQG     71 - 140
RYPHIKDGEDLKDHSTESKKMENCLGESRHEVEKSEISENTDASGKIEKYNVPLNRLKMMFEKGEPTQTK    141 - 210
ILRAQSRSASGRKISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSK    211 - 280
QSSSTNYTNELKASGGEIKIHKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDSQVKS    281 - 350
EVQQPVHPKPLSPDSRASSLSESSPPKAMKKFQAPARETCVECQKTVYPMERLLANQQVFHISCFRCSYC    351 - 420
NNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHRPHKDLWASKNENEEILERPAQLANARETPHS    421 - 490
PGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGIKMSKPKWPPED    491 - 560
EISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASFQSTSVKSPKTVSPPIRKGWSMSEQSEESVGGRV    561 - 630
AERKQVENAKASKKNGNVGKTTWQNKESKGETGKRSKEGHSLEMENENLVENGADSDEDDNSFLKQQSPQ    631 - 700
EPKSLNWSSFVDNTFAEEFTTQNQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE               701 - 759
//

Text Mined References (47)

PMID Year Title