Property Summary

NCBI Gene PubMed Count 34
Grant Count 18
R01 Count 15
Funding $1,413,242.3
PubMed Score 22.92
PubTator Score 29.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26350886 EPLIN is functionally linked to molecules like actin and paxillin and has been implicated in a number of potential pathways to enhance metastatic potential
25496916 LIM domain and actin binding 1 (LIMA1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24135282 a major activity of DNp73 is to establish initiation of the invasion-metastasis cascade via EPLIN-dependent IGF1R regulation
23188829 EGF promotes epithelial-mesenchymal transition and induces degradation of EPLIN, a putative suppressor of prostate cancer metastasis.
22493360 Together with the findings that EPLIN-alpha inhibits cellular growth and invasion, we conclude that EPLIN-alpha is a tumour suppressor of oesophageal cancer
22194609 EPLIN clutch is necessary for stabilization of capillary structures in an angiogenesis model.
21625216 EPLIN downregulation promotes epithelial-mesenchymal transition in prostate cancer cells and correlates with clinical lymph node metastasis.
20848180 EPLINalpha over-expression can regulate HECV cell motility, matrix adhesion and tubule formation in vitro and slow in vivo tumour formation, suggesting an anti-angiogenic role for EPLINalpha.
19221476 EPLIN protein may function during cytokinesis to maintain local accumulation of key cytokinesis proteins at the furrow.
18796137 expression of EPLIN-alpha in breast cancer is down-regulated in breast cancer cells .
More...

AA Sequence

MESSPFNRRQWTSLSLRVTAKELSLVNKNKSSAIVEIFSKYQKAAEETNMEKKRSNTENLSQHFRKGTLT      1 - 70
VLKKKWENPGLGAESHTDSLRNSSTEIRHRADHPPAEVTSHAASGAKADQEEQIHPRSRLRSPPEALVQG     71 - 140
RYPHIKDGEDLKDHSTESKKMENCLGESRHEVEKSEISENTDASGKIEKYNVPLNRLKMMFEKGEPTQTK    141 - 210
ILRAQSRSASGRKISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSK    211 - 280
QSSSTNYTNELKASGGEIKIHKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDSQVKS    281 - 350
EVQQPVHPKPLSPDSRASSLSESSPPKAMKKFQAPARETCVECQKTVYPMERLLANQQVFHISCFRCSYC    351 - 420
NNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHRPHKDLWASKNENEEILERPAQLANARETPHS    421 - 490
PGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGIKMSKPKWPPED    491 - 560
EISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASFQSTSVKSPKTVSPPIRKGWSMSEQSEESVGGRV    561 - 630
AERKQVENAKASKKNGNVGKTTWQNKESKGETGKRSKEGHSLEMENENLVENGADSDEDDNSFLKQQSPQ    631 - 700
EPKSLNWSSFVDNTFAEEFTTQNQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE               701 - 759
//

Text Mined References (46)

PMID Year Title
26350886 2015 EPLIN: a fundamental actin regulator in cancer metastasis?
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24135282 2013 DNp73 exerts function in metastasis initiation by disconnecting the inhibitory role of EPLIN on IGF1R-AKT/STAT3 signaling.
23188829 2013 Epidermal growth factor promotes protein degradation of epithelial protein lost in neoplasm (EPLIN), a putative metastasis suppressor, during epithelial-mesenchymal transition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22493360 2012 EPLIN-? expression in human oesophageal cancer and its impact on cellular aggressiveness and clinical outcome.
22194609 2012 Epithelial protein lost in neoplasm (EPLIN) interacts with ?-catenin and actin filaments in endothelial cells and stabilizes vascular capillary network in vitro.
More...