Property Summary

NCBI Gene PubMed Count 34
PubMed Score 15.02
PubTator Score 71.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 6.2e-06
Breast cancer -1.300 2.0e-09
glioblastoma 1.100 5.1e-03
interstitial cystitis -1.300 1.9e-03
intraductal papillary-mucinous neoplasm ... 1.600 2.7e-02
medulloblastoma, large-cell -1.400 7.0e-04
Multiple myeloma 1.088 2.4e-02
ovarian cancer -2.000 1.7e-06
pancreatic ductal adenocarcinoma liver m... -1.005 1.8e-02
psoriasis 1.200 1.3e-04

 GO Function (1)

Gene RIF (6)

AA Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKS      1 - 70
IICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS                     71 - 124
//

Text Mined References (38)

PMID Year Title