Property Summary

NCBI Gene PubMed Count 33
Grant Count 15
R01 Count 15
Funding $728,773.43
PubMed Score 14.05
PubTator Score 71.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

 GO Function (1)

Gene RIF (5)

PMID Text
25661340 The present study was aimed at investigating whether the miR-29c binding site single nucleotide polymorphisms within the 3'-UTRs of LAMTOR3 gene affected the gastric cancer risk.
23408059 we demonstrate that the MAPK scaffold protein MEK partner 1 (MP1) is important for gastrin-induced phosphorylation of ERK1 and ERK2 and that MP1 promotes gastrin-induced proliferation of AGS-GR cells
23341997 identified polymorphisms in LAMTOR2 and LAMTOR3 do not seem to play a relevant role in breast cancer
20381137 A complex encoded by the MAPKSP1, ROBLD3, and c11orf59 genes interacts with the Rag GTPases, recruits them to lysosomes, and is essential for mTORC1 activation
17113937 We investigated the neuroprotective effect of glial-derived neurotrophic factor (GDNF) upon alcohol-exposed B92 cultures, as well as the role of the cytoskeleton and mitogen-activated protein kinase (MAPK) pathways in this effect.

AA Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKS      1 - 70
IICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS                     71 - 124
//

Text Mined References (37)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25661340 2015 A miR-29c binding site genetic variant in the 3'-untranslated region of LAMTOR3 gene is associated with gastric cancer risk.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25416956 2014 A proteome-scale map of the human interactome network.
23408059 2013 Gastrin-induced proliferation involves MEK partner 1 (MP1).
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23341997 2013 Polymorphisms in the gene regions of the adaptor complex LAMTOR2/LAMTOR3 and their association with breast cancer risk.
22980980 2012 Ragulator is a GEF for the rag GTPases that signal amino acid levels to mTORC1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
More...