Property Summary

NCBI Gene PubMed Count 34
PubMed Score 15.02
PubTator Score 71.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 6.2e-06
Breast cancer -1.300 2.0e-09
glioblastoma 1.100 5.1e-03
interstitial cystitis -1.300 1.9e-03
intraductal papillary-mucinous neoplasm ... 1.600 2.7e-02
medulloblastoma, large-cell -1.400 7.0e-04
Multiple myeloma 1.088 2.4e-02
ovarian cancer -2.000 1.7e-06
pancreatic ductal adenocarcinoma liver m... -1.005 1.8e-02
psoriasis 1.200 1.3e-04

Synonym

Accession Q9UHA4 B2R4A1 J3KMX4 Q9H364
Symbols MP1
MAPBP
MAPKSP1
PRO0633
MAP2K1IP1
Ragulator3

Gene

PDB

6B9X   6EHP   6EHR   1SKO   2ZL1   3CPT  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (6)

AA Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKS      1 - 70
IICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS                     71 - 124
//

Text Mined References (38)

PMID Year Title