Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.03
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
acute quadriplegic myopathy 1157 3.52088835284489E-5
ovarian cancer 8492 2.1015963237084E-4
astrocytoma 1493 8.48049216204615E-4
lung cancer 4473 8.54039655820439E-4
Multiple myeloma 1328 0.00148136981268806
hereditary spastic paraplegia 313 0.00152596858272795
Breast cancer 3099 0.0482717806457092
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0
Disease Target Count Z-score Confidence
Diamond-Blackfan anemia 30 3.471 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.075 0.001
astrocytoma -1.400 0.001
hereditary spastic paraplegia -1.572 0.002
acute quadriplegic myopathy 1.103 0.000
lung cancer 1.100 0.001
Breast cancer 2.800 0.048
ovarian cancer -1.700 0.000

Synonym

Accession Q9UHA3 B2RD72 Q561V8 Q8N6S8 Q96B04 Q96C76 Q96HJ1
Symbols L30
RLP24
RPL24
TVAS3
RPL24L
C15orf15
HRP-L30-iso

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFE      1 - 70
FEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAG     71 - 140
KGKQLEEKMVQQLQEDVDMEDAP                                                   141 - 163
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18562305 2008 Expression profiling of PBMC-based diagnostic gene markers isolated from vasculitis patients.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...