Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 4
Funding $324,925
PubMed Score 5.03
PubTator Score 2.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.075 0.001
astrocytoma -1.400 0.001
hereditary spastic paraplegia -1.572 0.002
acute quadriplegic myopathy 1.103 0.000
lung cancer 1.100 0.001
Breast cancer 2.800 0.048
ovarian cancer -1.700 0.000

Synonym

Accession Q9UHA3 B2RD72 Q561V8 Q8N6S8 Q96B04 Q96C76 Q96HJ1
Symbols L30
RLP24
RPL24
TVAS3
RPL24L
C15orf15
HRP-L30-iso

Gene

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFE      1 - 70
FEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAG     71 - 140
KGKQLEEKMVQQLQEDVDMEDAP                                                   141 - 163
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18562305 2008 Expression profiling of PBMC-based diagnostic gene markers isolated from vasculitis patients.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...