Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.26
PubTator Score 0.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.066 0.006
Multiple myeloma 1.221 0.002

Synonym

Accession Q9UHA2 B2R5L1
Symbols KIAA-iso

Gene

 Compartment GO Term (0)

AA Sequence

MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPT      1 - 70
STSKAME                                                                    71 - 77
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11435705 2001 Mapping and characterization of the mouse and human SS18 genes, two human SS18-like genes and a mouse Ss18 pseudogene.