Property Summary

NCBI Gene PubMed Count 42
Grant Count 19
R01 Count 14
Funding $1,724,021.95
PubMed Score 34.63
PubTator Score 31.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.209 0.000
atypical teratoid/rhabdoid tumor -1.400 0.000
lung cancer -1.600 0.000
subependymal giant cell astrocytoma -1.553 0.013
ovarian cancer -1.100 0.000

Gene RIF (14)

PMID Text
26865710 SUN2 overexpression perturbs both nuclear shape and early events of HIV infection
26658802 SUN2 exerts tumor suppressor functions by suppressing the Warburg effect in lung cancer
26356418 Nuclear envelope associated endosome-mediated transfer depends on the nuclear envelope proteins SUN1 and SUN2, as well as the Sec61 translocon complex.
25210889 An important role for SUN1 and SUN2 in muscle disease pathogenesis.
24832085 SUN2 as a tumor suppressor mediates miR-221 and miR-222 functions in central nervous system embryonal tumors.
24662567 Codepletion of SUN1/2 slows cell proliferation and results in an accumulation of morphologically defective and disoriented mitotic spindles.
22632968 Study presents crystal structures of the human SUN2-KASH1/2 complex, i.e. SUN2 complexed with the C-terminal 29 residues of human Nesprin-1 or -2 (the core of the LINC complex).
22170055 the crystal structure of the SUN2 protein SUN domain
21655223 Data found that expression of lamin A but not lamin C partly restored the nuclear envelope localization of SUN2.
20551905 Data suggest that SUN2 represents the first mammalian inner nuclear membrane (INM) protein relying on a functional nuclear localization signal, a Golgi retrieval signal and a perinuclear domain to mediate targeting to the INM.
More...

AA Sequence

MSRRSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNMKRLSPAPQLGPSSDAHTSYY      1 - 70
SESLVHESWFPPRSSLEELHGDANWGEDLRVRRRRGTGGSESSRASGLVGRKATEDFLGSSSGYSSEDDY     71 - 140
VGYSDVDQQSSSSRLRSAVSRAGSLLWMVATSPGRLFRLLYWWAGTTWYRLTTAASLLDVFVLTRRFSSL    141 - 210
KTFLWFLLPLLLLTCLTYGAWYFYPYGLQTFHPALVSWWAAKDSRRPDEGWEARDSSPHFQAEQRVMSRV    211 - 280
HSLERRLEALAAEFSSNWQKEAMRLERLELRQGAPGQGGGGGLSHEDTLALLEGLVSRREAALKEDFRRE    281 - 350
TAARIQEELSALRAEHQQDSEDLFKKIVRASQESEARIQQLKSEWQSMTQESFQESSVKELRRLEDQLAG    351 - 420
LQQELAALALKQSSVAEEVGLLPQQIQAVRDDVESQFPAWISQFLARGGGGRVGLLQREEMQAQLRELES    421 - 490
KILTHVAEMQGKSAREAAASLSLTLQKEGVIGVTEEQVHHIVKQALQRYSEDRIGLADYALESGGASVIS    491 - 560
TRCSETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTAVTLEHVP    561 - 630
KALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGH    631 - 700
PEYTCIYRFRVHGEPAH                                                         701 - 717
//

Text Mined References (51)

PMID Year Title
26865710 2016 SUN2 Overexpression Deforms Nuclear Shape and Inhibits HIV.
26658802 2015 SUN2 exerts tumor suppressor functions by suppressing the Warburg effect in lung cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26356418 2015 Nuclear envelope-associated endosomes deliver surface proteins to the nucleus.
25416956 2014 A proteome-scale map of the human interactome network.
25210889 2014 Muscular dystrophy-associated SUN1 and SUN2 variants disrupt nuclear-cytoskeletal connections and myonuclear organization.
24832085 2014 Downregulation of SUN2, a novel tumor suppressor, mediates miR-221/222-induced malignancy in central nervous system embryonal tumors.
24662567 2014 SUN proteins facilitate the removal of membranes from chromatin during nuclear envelope breakdown.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...