Property Summary

NCBI Gene PubMed Count 21
Grant Count 20
R01 Count 18
Funding $1,585,983.93
PubMed Score 2336.66
PubTator Score 30.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.100 0.001
osteosarcoma 2.337 0.000
glioblastoma 1.200 0.001
medulloblastoma, large-cell 1.300 0.002
lung cancer 1.200 0.006
group 3 medulloblastoma 1.400 0.000
ovarian cancer 1.600 0.000

Gene RIF (6)

PMID Text
25640402 Knockdown of MondoA, or its dimerization partner Mlx, blocks Myc-induced reprogramming of multiple metabolic pathways, resulting in apoptosis
24857747 MYC is part of a network of bHLHLZ proteins centered on the MYC heterodimeric partner MAX and its counterpart, the MAX-like protein MLX.
18458340 These studies suggest a key role for MondoA:Mlx complexes in the adaptive transcriptional response to changes in extracellular glucose concentration and peripheral glucose uptake.
16782875 Endogenous MondoA and Mlx associate with mitochondria in primary skeletal muscle.
15664996 Mlx is an obligatory partner of ChREBP in regulating lipogenic enzyme genes in liver.
12446771 Data show that for both MondoA and Mlx, the C-terminal domain CRM-1 has cytoplasmic localization activity that is required by the protein monomers to accumulate in the cytoplasm.

AA Sequence

MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPTLSVPRGCREDSSHPACAKVE      1 - 70
YAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKESYKDRRRRAHTQAEQK     71 - 140
RRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKI    141 - 210
MKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQ    211 - 280
TLREIVIGVLHQLKNQLY                                                        281 - 298
//

Text Mined References (23)

PMID Year Title
25640402 2015 Deregulated Myc requires MondoA/Mlx for metabolic reprogramming and tumorigenesis.
25416956 2014 A proteome-scale map of the human interactome network.
24857747 2015 Functional interactions among members of the MAX and MLX transcriptional network during oncogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23756994 2013 Classification and evolutionary analysis of the basic helix-loop-helix gene family in the green anole lizard, Anolis carolinensis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
18458340 2008 Glucose sensing by MondoA:Mlx complexes: a role for hexokinases and direct regulation of thioredoxin-interacting protein expression.
16782875 2006 MondoA-Mlx heterodimers are candidate sensors of cellular energy status: mitochondrial localization and direct regulation of glycolysis.
More...