Property Summary

Ligand Count 8
NCBI Gene PubMed Count 22
PubMed Score 2368.91
PubTator Score 30.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.200 9.7e-04
group 3 medulloblastoma 1.100 2.8e-04
lung cancer 1.200 6.3e-03
medulloblastoma, large-cell 1.300 2.4e-03
osteosarcoma 2.337 6.2e-10
ovarian cancer 1.600 4.3e-05
psoriasis 1.100 1.3e-03

Gene RIF (6)

AA Sequence

MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPTLSVPRGCREDSSHPACAKVE      1 - 70
YAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKESYKDRRRRAHTQAEQK     71 - 140
RRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKI    141 - 210
MKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQ    211 - 280
TLREIVIGVLHQLKNQLY                                                        281 - 298
//

Text Mined References (24)

PMID Year Title