Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.41
PubTator Score 2.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 0.006
ependymoma -1.100 0.007
non diabetic and post-ischemic heart fai... 1.500 0.038
Duchenne muscular dystrophy -1.757 0.000
limb girdle muscular dystrophy 2B -1.383 0.001
acute quadriplegic myopathy -2.301 0.000
psoriasis -1.300 0.000

Gene RIF (1)

PMID Text
17928169 FBXO40 may function as a regulator involved in the postnatal myogenesis.

AA Sequence

MGKARRSPPGHHRHCEGCFNRHCHIPVEPNTSCLVISCHLLCGATFHMCKEAEHQLLCPLEQVPCLNSEY      1 - 70
GCPLSMSRHKLAKHLQVCPASVVCCSMEWNRWPNVDSETTLHENIMKETPSEECLDTALALQDQKVLFRS     71 - 140
LKMVELFPETREATEEEPTMNGETSVEEMGGAVGGVDIGLVPHGLSATNGEMAELSQEEREVLAKTKEGM    141 - 210
DLVKFGQWENIFSKEHAASALTNSSASCESKNKNDSEKEQISSGHNMVEGEGAPKKKEPQENQKQQDVRT    211 - 280
AMETTGLAPWQDGVLERLKTAVDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGKLEAQEVKTVYTF    281 - 350
KVPVSYCGKRARLGDAMLSCKPSEHKAVDTSDLGITVEDLPKSDLIKTTLQCALERELKGHVISESRSID    351 - 420
GLFMDFATQTYNFEPEQFSSGTVLADLTAATPGGLHVELHSECVTRRHNKSSSAFTFTCNKFFRRDEFPL    421 - 490
HFKNVHTDIQSCLNGWFQHRCPLAYLGCTFVQNHFRPPGQKAKVIYSQELKTFAIKPEVAPELSEGRKNN    491 - 560
HLLGHGGKSQNSLTSLPLEILKYIAGFLDSVSLAQLSQVSVLMRNICATLLQERGMVLLQWKKKRYSHGG    561 - 630
TSWRVHREIWQFSSLFSKIKSWEFNEVTSMSEHLKSCPFNIVEHKTDPILLTSMCQPREQARESLVSTFR    631 - 700
IRPRGRYVS                                                                 701 - 709
//

Text Mined References (11)

PMID Year Title
23223146 2013 A genome-wide association study in Caucasian women points out a putative role of the STXBP5L gene in facial photoaging.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17928169 2007 FBXO40, a gene encoding a novel muscle-specific F-box protein, is upregulated in denervation-related muscle atrophy.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...