Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.45
PubTator Score 2.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy -2.011 4.0e-05
astrocytic glioma -1.100 6.4e-03
Duchenne muscular dystrophy -1.757 1.1e-06
ependymoma -1.100 6.6e-03
limb girdle muscular dystrophy 2A -1.127 7.8e-03
non diabetic and post-ischemic heart fai... 1.500 3.8e-02
psoriasis -1.300 1.9e-12

Gene RIF (1)

AA Sequence

MGKARRSPPGHHRHCEGCFNRHCHIPVEPNTSCLVISCHLLCGATFHMCKEAEHQLLCPLEQVPCLNSEY      1 - 70
GCPLSMSRHKLAKHLQVCPASVVCCSMEWNRWPNVDSETTLHENIMKETPSEECLDTALALQDQKVLFRS     71 - 140
LKMVELFPETREATEEEPTMNGETSVEEMGGAVGGVDIGLVPHGLSATNGEMAELSQEEREVLAKTKEGM    141 - 210
DLVKFGQWENIFSKEHAASALTNSSASCESKNKNDSEKEQISSGHNMVEGEGAPKKKEPQENQKQQDVRT    211 - 280
AMETTGLAPWQDGVLERLKTAVDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGKLEAQEVKTVYTF    281 - 350
KVPVSYCGKRARLGDAMLSCKPSEHKAVDTSDLGITVEDLPKSDLIKTTLQCALERELKGHVISESRSID    351 - 420
GLFMDFATQTYNFEPEQFSSGTVLADLTAATPGGLHVELHSECVTRRHNKSSSAFTFTCNKFFRRDEFPL    421 - 490
HFKNVHTDIQSCLNGWFQHRCPLAYLGCTFVQNHFRPPGQKAKVIYSQELKTFAIKPEVAPELSEGRKNN    491 - 560
HLLGHGGKSQNSLTSLPLEILKYIAGFLDSVSLAQLSQVSVLMRNICATLLQERGMVLLQWKKKRYSHGG    561 - 630
TSWRVHREIWQFSSLFSKIKSWEFNEVTSMSEHLKSCPFNIVEHKTDPILLTSMCQPREQARESLVSTFR    631 - 700
IRPRGRYVS                                                                 701 - 709
//

Text Mined References (12)

PMID Year Title