Property Summary

NCBI Gene PubMed Count 24
Grant Count 7
R01 Count 3
Funding $420,620.25
PubMed Score 15.78
PubTator Score 13.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (13)

PMID Text
26435498 Akt and PKA phosphorylated KLHL3 at S433, and phosphorylation of KLHL3 by PKA inhibited WNK4 degradation.
26349538 Data indicate that WNK lysine deficient protein kinase 4 protein (WNK4) was degraded not only by proteasomes but also by atypical protein kinase C scaffold protein p62 (p62)-kelch-like 3 protein (KLHL3)-mediated selective autophagy.
25925082 Familial hyperkalemia and hypertension caused by KLHL3 mutations is accompanied by hypercalciuria as well as hyperkalemia and hypertension.
25313067 KLHL3 is phosphorylated at serine 433 in the Kelch domain (a site frequently mutated in hypertension with hyperkalemia) by protein kinase C in cultured cells and that this phosphorylation prevents WNK4 binding and degradation.
25250572 Hyperkalemic hypertension-associated cul3 mutations depletes KLHL3, preventing WNK degradation, despite increased CUL3-mediated WNK ubiquitylation.
24266877 CUL3 and KLHL3 gene products are physiologically important regulators of thiazide-sensitive distal nephron sodium chloride reabsorption.
23962426 analysis of how mutations of KLHL3 show less ability to ubiquitinate WNK4 because of KLHL3's low stability and/or decreased binding to CUL3 or WNK4
23665031 KLHL3 is a substrate adaptor for WNK4 in a ubiquitin E3 ligase complex
23576762 CUL3 and KLHL3 have roles in in electrolyte homeostasis and in Pseudohypoaldosteronism type II
23573258 Disease causing mutations in human KLHL3 disrupt the interaction with CUL3, a crystallographic study.
More...

AA Sequence

MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAA      1 - 70
CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCC     71 - 140
DFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSE    141 - 210
EKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPL    211 - 280
DQRLLIKNPRTKPRTPVSLPKVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVY    281 - 350
AVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNE    351 - 420
WFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLSG    421 - 490
QLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPV    491 - 560
TDKWTLLPTNMSTGRSYAGVAVIHKSL                                               561 - 587
//

Text Mined References (23)

PMID Year Title
26435498 2015 Impaired degradation of WNK by Akt and PKA phosphorylation of KLHL3.
26349538 2015 Involvement of selective autophagy mediated by p62/SQSTM1 in KLHL3-dependent WNK4 degradation.
25925082 2015 Hypercalciuria in familial hyperkalemia and hypertension with KLHL3 mutations.
25313067 2014 Angiotensin II signaling via protein kinase C phosphorylates Kelch-like 3, preventing WNK4 degradation.
25250572 2014 Hyperkalemic hypertension-associated cullin 3 promotes WNK signaling by degrading KLHL3.
24266877 2014 Detection of mutations in KLHL3 and CUL3 in families with FHHt (familial hyperkalaemic hypertension or Gordon's syndrome).
23962426 2013 Decrease of WNK4 ubiquitination by disease-causing mutations of KLHL3 through different molecular mechanisms.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23665031 2013 Disease-causing mutations in KLHL3 impair its effect on WNK4 degradation.
More...