Property Summary

NCBI Gene PubMed Count 28
PubMed Score 19.18
PubTator Score 13.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -2.300 2.4e-05
astrocytic glioma -1.200 6.1e-03
Astrocytoma, Pilocytic -1.700 3.0e-06
atypical teratoid / rhabdoid tumor -2.200 2.0e-06
ependymoma -2.100 3.7e-12
glioblastoma -2.000 6.5e-10
group 3 medulloblastoma -1.700 5.1e-03
intraductal papillary-mucinous adenoma (... 1.900 7.6e-04
intraductal papillary-mucinous neoplasm ... 2.300 2.9e-03
lung cancer -1.400 2.1e-02
lung carcinoma 1.500 5.9e-26
malignant mesothelioma -2.100 6.4e-08
medulloblastoma, large-cell -3.100 4.9e-05
oligodendroglioma -1.100 5.0e-12
Pick disease -1.500 5.9e-05
primitive neuroectodermal tumor -1.500 8.8e-03
subependymal giant cell astrocytoma -2.163 6.9e-03

Gene RIF (16)

AA Sequence

MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAA      1 - 70
CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCC     71 - 140
DFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSE    141 - 210
EKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPL    211 - 280
DQRLLIKNPRTKPRTPVSLPKVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVY    281 - 350
AVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNE    351 - 420
WFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLSG    421 - 490
QLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPV    491 - 560
TDKWTLLPTNMSTGRSYAGVAVIHKSL                                               561 - 587
//

Text Mined References (31)

PMID Year Title