Property Summary

NCBI Gene PubMed Count 19
Grant Count 21
R01 Count 20
Funding $2,282,646.83
PubMed Score 27.58
PubTator Score 28.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.293 0.003
astrocytic glioma -1.300 0.045
ependymoma 1.300 0.000
glioblastoma 1.100 0.004
medulloblastoma, large-cell -1.100 0.027
Duchenne muscular dystrophy 1.042 0.000
autosomal dominant Emery-Dreifuss muscul... 1.144 0.002
tuberculosis -1.200 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.043
lung cancer -2.100 0.001
pilocytic astrocytoma 1.500 0.000
primary Sjogren syndrome 1.500 0.000
aldosterone-producing adenoma -1.178 0.018
lung carcinoma -1.300 0.000
spina bifida -1.156 0.040
Pick disease 1.200 0.000
Breast cancer -1.200 0.000
gastric carcinoma 1.700 0.004
invasive ductal carcinoma -1.400 0.002
ulcerative colitis 1.900 0.000
ovarian cancer -2.500 0.000
Down syndrome 1.300 0.001
dermatomyositis 1.100 0.010

Gene RIF (12)

PMID Text
25889342 SWAP70 appears to act as a molecular intermediate between vGPCR and endothelial activation.
22944692 Positional proteomics analysis identifies the cleavage of human SWAP switching B-cell complex 70kDa subunit (SWAP70) at amino acid residues 566-567 by the HIV-1 protease
22728961 Detection of SWAP70 antibodies during the attack period might suggest that SWAP70 is involved in Multiple Sclerosis relapse pathogenesis
22247562 The unwinding of the C-terminal alpha-helix could regulate the functions of SWAP-70 at the plasma membrane surface.
22210919 findings suggest that regulation of eosinophil trafficking and migration by SWAP-70 is important for the development of eosinophilic inflammation after allergen exposure
21360565 SWAP70 may be a target of miR-145, and it might have a potential oncogenic function.
20800603 Observational study of gene-disease association. (HuGE Navigator)
17371938 SWAP-70 may be involved in regulating migration and invasion of trophoblast cells during the processes of embryonic implantation and placentation in primates.
16547421 surface expression of SWAP-70 on HIV-1 infected cells as well as PBMCs; SWAP-70 may serve as a marker for T cell differentiation as well as for HIV-1 infection
16418221 the binding activity of SWAP-70 to non-muscle F-actin is required for membrane ruffling.
More...

AA Sequence

MGSLKEELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYM      1 - 70
PYLNRFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLLITEEDAFKIWVIFNFLSEDKYPLIIVSEEIE     71 - 140
YLLKKLTEAMGGGWQQEQFEHYKINFDDSKNGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILD    141 - 210
VLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCF    211 - 280
DKTFEISASDKKKKQEWIQAIHSTIHLLKLGSPPPHKEARQRRKELRKKQLAEQEELERQMKELQAANES    281 - 350
KQQELEAVRKKLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR    351 - 420
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEAEKQELENQRV    421 - 490
LKEQALQEAMEQLEQLELERKQALEQYEEVKKKLEMATNKTKSWKDKVAHHEGLIRLIEPGSKNPHLITN    491 - 560
WGPAAFTEAELEEREKNWKEKKTTE                                                 561 - 585
//

Text Mined References (21)

PMID Year Title
25889342 2015 The guanine exchange factor SWAP70 mediates vGPCR-induced endothelial plasticity.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
22728961 2012 Switch-associated protein 70 antibodies in multiple sclerosis: relationship between increased serum levels and clinical relapse.
22247562 2012 Membrane-induced alteration of the secondary structure in the SWAP-70 pleckstrin homology domain.
22210919 2012 Regulation of eosinophil trafficking by SWAP-70 and its role in allergic airway inflammation.
21360565 2011 SWAP70, actin-binding protein, function as an oncogene targeting tumor-suppressive miR-145 in prostate cancer.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...