Property Summary

NCBI Gene PubMed Count 21
PubMed Score 29.58
PubTator Score 28.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
aldosterone-producing adenoma -1.178 1.8e-02
astrocytic glioma -1.300 4.5e-02
Astrocytoma, Pilocytic 1.200 1.3e-05
autosomal dominant Emery-Dreifuss muscul... 1.144 1.5e-03
Breast cancer -1.200 1.2e-07
dermatomyositis 1.100 1.0e-02
Down syndrome 1.300 1.4e-03
Duchenne muscular dystrophy 1.042 5.3e-08
ependymoma 1.300 1.2e-06
gastric carcinoma 1.700 4.1e-03
glioblastoma 1.100 4.2e-03
intraductal papillary-mucinous adenoma (... -1.200 4.3e-02
invasive ductal carcinoma -1.400 2.4e-03
lung cancer -1.300 1.2e-02
lung carcinoma -1.300 3.0e-18
medulloblastoma, large-cell -1.100 2.7e-02
ovarian cancer -1.100 2.6e-05
Pick disease 1.200 7.1e-05
primary Sjogren syndrome 1.200 2.1e-03
spina bifida -1.156 4.0e-02
tuberculosis -1.200 9.3e-05
ulcerative colitis 1.400 2.0e-05
Waldenstrons macroglobulinemia 1.293 2.7e-03

Gene RIF (14)

AA Sequence

MGSLKEELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYM      1 - 70
PYLNRFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLLITEEDAFKIWVIFNFLSEDKYPLIIVSEEIE     71 - 140
YLLKKLTEAMGGGWQQEQFEHYKINFDDSKNGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILD    141 - 210
VLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCF    211 - 280
DKTFEISASDKKKKQEWIQAIHSTIHLLKLGSPPPHKEARQRRKELRKKQLAEQEELERQMKELQAANES    281 - 350
KQQELEAVRKKLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR    351 - 420
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEAEKQELENQRV    421 - 490
LKEQALQEAMEQLEQLELERKQALEQYEEVKKKLEMATNKTKSWKDKVAHHEGLIRLIEPGSKNPHLITN    491 - 560
WGPAAFTEAELEEREKNWKEKKTTE                                                 561 - 585
//

Text Mined References (23)

PMID Year Title