Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
inflammatory breast cancer 286 4.6e-02

Expression

Synonym

Accession Q9UH64 Q5VVJ4
Symbols C9orf53
bA149I2.3

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MRQRGQEHLPTSVKSEPRACNNPTVAENRRVPSGLAAVIRNLTALWNPSLGVSERRGGDWEPSRIPRLWA      1 - 70
RVGWIQLPG                                                                  71 - 79
//

Text Mined References (6)

PMID Year Title