Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00104821351867176
inflammatory breast cancer 404 0.0460911050039178

Synonym

Accession Q9UH64 Q5VVJ4
Symbols C9orf53
bA149I2.3

Gene

 Compartment GO Term (1)

Gene RIF (4)

PMID Text
21406102 A chromosome 9p21.3 variant predicts the risk of myocardial infarction among white men.
21385355 Six sequence variants on chromosome 9p21.3 are associated with a positive family history of myocardial infarction.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19664850 The C allele of rs1333049 in the vascular disease susceptibility locus is associated with vascular dementia and late-onset Alzheimer's disease, independent of traditional risk factors.

AA Sequence

MRQRGQEHLPTSVKSEPRACNNPTVAENRRVPSGLAAVIRNLTALWNPSLGVSERRGGDWEPSRIPRLWA      1 - 70
RVGWIQLPG                                                                  71 - 79
//

Text Mined References (6)

PMID Year Title
21406102 2011 The contribution of a 9p21.3 variant, a KIF6 variant, and C-reactive protein to predicting risk of myocardial infarction in a prospective study.
21385355 2011 Six sequence variants on chromosome 9p21.3 are associated with a positive family history of myocardial infarction: a multicenter registry.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
19664850 2011 Chromosome 9p21.3 genotype is associated with vascular dementia and Alzheimer's disease.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15164053 2004 DNA sequence and analysis of human chromosome 9.