Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q9UH64 Q5VVJ4
Symbols C9orf53
bA149I2.3

Gene

 Compartment GO Term (1)

Gene RIF (4)

PMID Text
21406102 A chromosome 9p21.3 variant predicts the risk of myocardial infarction among white men.
21385355 Six sequence variants on chromosome 9p21.3 are associated with a positive family history of myocardial infarction.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19664850 The C allele of rs1333049 in the vascular disease susceptibility locus is associated with vascular dementia and late-onset Alzheimer's disease, independent of traditional risk factors.

AA Sequence

MRQRGQEHLPTSVKSEPRACNNPTVAENRRVPSGLAAVIRNLTALWNPSLGVSERRGGDWEPSRIPRLWA      1 - 70
RVGWIQLPG                                                                  71 - 79
//

Text Mined References (6)

PMID Year Title
21406102 2011 The contribution of a 9p21.3 variant, a KIF6 variant, and C-reactive protein to predicting risk of myocardial infarction in a prospective study.
21385355 2011 Six sequence variants on chromosome 9p21.3 are associated with a positive family history of myocardial infarction: a multicenter registry.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
19664850 2011 Chromosome 9p21.3 genotype is associated with vascular dementia and Alzheimer's disease.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15164053 2004 DNA sequence and analysis of human chromosome 9.