Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.28
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.200 0.001
esophageal adenocarcinoma 1.200 0.030
osteosarcoma 1.093 0.009
medulloblastoma, large-cell -1.900 0.001
juvenile dermatomyositis 1.662 0.000
tuberculosis and treatment for 6 months -1.700 0.000
active Crohn's disease 1.607 0.003
group 3 medulloblastoma -1.400 0.019
pancreatic carcinoma 1.200 0.001
subependymal giant cell astrocytoma 1.346 0.026
lung adenocarcinoma 1.104 0.000
psoriasis -1.200 0.000
ulcerative colitis 1.900 0.000
ovarian cancer 2.500 0.000
dermatomyositis 1.300 0.012

Gene RIF (1)

PMID Text
23844091 The Wnt pathway regulates mitochondrial distribution and dynamics through Alex3 protein degradation.

AA Sequence

MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNES      1 - 70
KSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILE     71 - 140
AALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDD    141 - 210
TITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTREL    211 - 280
LRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGI    281 - 350
ESHHDFLVKVKVGKFMAKLAEHMFPKSQE                                             351 - 379
//

Text Mined References (20)

PMID Year Title
23844091 2013 The non-canonical Wnt/PKC pathway regulates mitochondrial dynamics through degradation of the arm-like domain-containing protein Alex3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22569362 2012 The Eutherian Armcx genes regulate mitochondrial trafficking in neurons and interact with Miro and Trak2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19304657 2009 The armadillo repeat-containing protein, ARMCX3, physically and functionally interacts with the developmental regulatory factor Sox10.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...