Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.70
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.341 6.5e-03
dermatomyositis 1.300 1.2e-02
esophageal adenocarcinoma 1.200 3.0e-02
group 3 medulloblastoma -1.400 1.9e-02
juvenile dermatomyositis 1.662 5.0e-10
lung adenocarcinoma 1.104 2.6e-04
medulloblastoma, large-cell -1.900 6.4e-04
osteosarcoma 1.093 9.4e-03
ovarian cancer -1.900 2.5e-06
pancreatic cancer 1.200 5.3e-04
pancreatic carcinoma 1.200 5.3e-04
psoriasis -1.200 6.6e-09
subependymal giant cell astrocytoma 1.346 2.6e-02
tuberculosis and treatment for 3 months -1.400 5.2e-05
ulcerative colitis 1.900 3.2e-08

Gene RIF (2)

AA Sequence

MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNES      1 - 70
KSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILE     71 - 140
AALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDD    141 - 210
TITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTREL    211 - 280
LRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGI    281 - 350
ESHHDFLVKVKVGKFMAKLAEHMFPKSQE                                             351 - 379
//

Text Mined References (21)

PMID Year Title