Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.08
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 5.13554377163166E-7
osteosarcoma 7933 3.41189616773642E-6
lung cancer 4473 2.58175791990143E-5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.028 0.000
lung cancer 2.100 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9UH36 Q6NXP8
Symbols SRR1L
HC/HCC

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid

 GO Process (1)

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
18293417 SOX2 enhancers SRR1 and SRR2 are each differentially methylated and acetylated, on a temporal basis, contributing to the generation of neuron- and astrocyte-specific epigenomes from a common progenitor cell.

AA Sequence

MAAAAAAALESWQAAAPRKRRSAARRPRRREAAPRGREAAPRGREAAPRGPEAEFESDSGVVLRRIWEAE      1 - 70
KDLFISDFWSSALETINRCLTKHLEQLKAPVGTLSDIFGNLHLDSLPEESDVATDSIPREILVTGTCHLK     71 - 140
CVCYGIGNFATCIVARNQLTFLLLLLEKCQIPRSHCWVYDPLFSQLEIEVLNTLGVTVLSENEEGKRSIR    141 - 210
GEPTIFYMLHCGTALYNNLLWSNWSVDALSKMVIIGNSFKGLEERLLARILQKNYPYIAKILKGLEELEF    211 - 280
PQTSQYMDIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSATD               281 - 339
//

Text Mined References (8)

PMID Year Title
18293417 2008 Epigenetic modifications of SOX2 enhancers, SRR1 and SRR2, correlate with in vitro neural differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8806657 1996 Molecular cloning of a novel mRNA highly expressed in haemochromatotic human liver and proliferating cells.