Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.67
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.1e-07
osteosarcoma 7950 9.2e-04
lung cancer 4740 2.9e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.400 2.9e-02
osteosarcoma -1.364 9.2e-04
ovarian cancer -1.300 5.1e-07

AA Sequence

MAAAAAAALESWQAAAPRKRRSAARRPRRREAAPRGREAAPRGREAAPRGPEAEFESDSGVVLRRIWEAE      1 - 70
KDLFISDFWSSALETINRCLTKHLEQLKAPVGTLSDIFGNLHLDSLPEESDVATDSIPREILVTGTCHLK     71 - 140
CVCYGIGNFATCIVARNQLTFLLLLLEKCQIPRSHCWVYDPLFSQLEIEVLNTLGVTVLSENEEGKRSIR    141 - 210
GEPTIFYMLHCGTALYNNLLWSNWSVDALSKMVIIGNSFKGLEERLLARILQKNYPYIAKILKGLEELEF    211 - 280
PQTSQYMDIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSATD               281 - 339
//

Text Mined References (7)

PMID Year Title