Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.08
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.028 0.000
lung cancer 2.100 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9UH36 Q6NXP8
Symbols SRR1L
HC/HCC

Gene

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
18293417 SOX2 enhancers SRR1 and SRR2 are each differentially methylated and acetylated, on a temporal basis, contributing to the generation of neuron- and astrocyte-specific epigenomes from a common progenitor cell.

AA Sequence

MAAAAAAALESWQAAAPRKRRSAARRPRRREAAPRGREAAPRGREAAPRGPEAEFESDSGVVLRRIWEAE      1 - 70
KDLFISDFWSSALETINRCLTKHLEQLKAPVGTLSDIFGNLHLDSLPEESDVATDSIPREILVTGTCHLK     71 - 140
CVCYGIGNFATCIVARNQLTFLLLLLEKCQIPRSHCWVYDPLFSQLEIEVLNTLGVTVLSENEEGKRSIR    141 - 210
GEPTIFYMLHCGTALYNNLLWSNWSVDALSKMVIIGNSFKGLEERLLARILQKNYPYIAKILKGLEELEF    211 - 280
PQTSQYMDIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSATD               281 - 339
//

Text Mined References (8)

PMID Year Title
18293417 2008 Epigenetic modifications of SOX2 enhancers, SRR1 and SRR2, correlate with in vitro neural differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8806657 1996 Molecular cloning of a novel mRNA highly expressed in haemochromatotic human liver and proliferating cells.