Property Summary

NCBI Gene PubMed Count 76
Grant Count 70
R01 Count 38
Funding $8,198,327.84
PubMed Score 80.74
PubTator Score 103.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung carcinoma 1.600 0.000
psoriasis 1.400 0.000

Synonym

Accession Q9UH17 B0QYD2 O95618 Q20WL1 Q5IFJ4 Q7Z2N3 Q7Z6D6 Q9UE74 A3B
Symbols A3B
ARP4
ARCD3
PHRBNL
APOBEC1L
bK150C2.2
DJ742C19.2

Gene

PANTHER Protein Class (2)

PDB

2NBQ   5CQD   5CQH   5CQI   5CQK  

Gene RIF (85)

PMID Text
26682542 These results suggest that functional potential of APOBEC3B and APOBEC3C involved in cancer mutagenesis is associated with estrogen receptor status.
26668372 Data show that restriction factor APOBEC3G (A3G) is susceptible to degradation by the HIV-1 Vif protein, whereas restriction factor APOBEC3B (A3B) is resistant to Vif.
26544511 Data indicate that SIVmac239 Vif protein efficiently degrades human DNA cytosine deaminase APOBEC3B protein (huA3B).
26420215 Multiple experimental approaches combined demonstrate direct transcriptional upregulation of APOBEC3B by a signal transduction pathway involving the classical protein kinase C isoform protein kinase Ca and the noncanonical NF-kB transcription factor RELB.
26416889 report the first structures of the APOBEC3B catalytic domain in multiple crystal forms. These structures reveal a tightly closed active site conformation and suggest that substrate accessibility is regulated by adjacent flexible loops
26411678 APOBEC3B is required for regulation of gene expression by ERalpha and acts by causing C-to-U deamination at ERalpha binding regions.
26384561 The N-terminal domain of A3B and at least three residues involved in DNA binding by the A3Bc catalytic domain contribute to the A3B attenuation of the double stranded DNA break phenotype.
26320772 Germline variant and deletion polymorphism in APOBEC3B gene are not associated with breast cancer risk.
26305823 The APOBEC3B deletion polymorphism was found to be associated with HBV, HCV, TTV, and T. gondii co-infection in Indonesian HIV-infected individuals.
26281709 This study defines and characterizes the catalytic domain of human APOBEC3B (A3B) enzyme.
More...

AA Sequence

MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVYFKPQYHAEMC      1 - 70
FLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYWERDYRRALCRLSQ     71 - 140
AGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRYLMDPDTFTFNFNNDPLVLR    141 - 210
RRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFIS    211 - 280
WSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWDTFVY    281 - 350
RQGCPFQPWDGLEEHSQALSGRLRAILQNQGN                                          351 - 382
//

Text Mined References (82)

PMID Year Title
27643540 2016 Association of germline variants in the APOBEC3 region with cancer risk and enrichment with APOBEC-signature mutations in tumors.
26682542 2015 Integrative genomic analysis reveals functional diversification of APOBEC gene family in breast cancer.
26668372 2015 Specific induction of endogenous viral restriction factors using CRISPR/Cas-derived transcriptional activators.
26544511 2015 Degradation of the cancer genomic DNA deaminase APOBEC3B by SIV Vif.
26420215 2015 The PKC/NF-?B signaling pathway induces APOBEC3B expression in multiple human cancers.
26416889 2015 Crystal Structure of the DNA Deaminase APOBEC3B Catalytic Domain.
26411678 2015 APOBEC3B-Mediated Cytidine Deamination Is Required for Estrogen Receptor Action in Breast Cancer.
26384561 2015 Molecular basis of the attenuated phenotype of human APOBEC3B DNA mutator enzyme.
26320772 2016 Impact of functional germline variants and a deletion polymorphism in APOBEC3A and APOBEC3B on breast cancer risk and survival in a Swedish study population.
26305823 2015 The APOBEC3B deletion polymorphism is associated with prevalence of hepatitis B virus, hepatitis C virus, Torque Teno virus, and Toxoplasma gondii co-infection among HIV-infected individuals.
More...