Property Summary

NCBI Gene PubMed Count 19
PubMed Score 86.51
PubTator Score 75.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Major Depressive Disorder 106
Disease Target Count P-value
glioblastoma multiforme 347 1.45666919522721E-15
lung carcinoma 2844 1.14085334721485E-13
astrocytoma 1493 4.50204602396001E-10
ependymoma 2514 1.4649529603749E-8
pilocytic astrocytoma 3086 6.25212366284252E-7
pediatric high grade glioma 2712 9.94847644089206E-5
atypical teratoid/rhabdoid tumor 1095 1.18920254276056E-4
pituitary cancer 1972 2.54381749912231E-4
medulloblastoma, large-cell 6234 8.33605726979159E-4
group 3 medulloblastoma 2254 0.00798187956376687
Disease Target Count Z-score Confidence
Impotence 45 6.636 3.3
Dyspepsia 34 4.191 2.1
Nasopharyngitis 11 3.983 2.0

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma multiforme -1.900 0.000
ependymoma -1.600 0.000
atypical teratoid/rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.200 0.001
pediatric high grade glioma -1.900 0.000
group 3 medulloblastoma -1.300 0.008
pilocytic astrocytoma -1.500 0.000
lung carcinoma 1.600 0.000
pituitary cancer 1.600 0.000

Synonym

Accession Q9UH03 B1AHR0 Q2NKJ7 Q59GF7 Q6IBZ6 Q8N3P3 Q9HD35
Symbols SEP3
bK250D10.3

Gene

PDB

3SOP   4Z51   4Z54  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (4)

PMID Text
24787956 Data indicate that forchlorfenuron (FCF) exhibits differential binding preference for septins SEPT2 and SEPT3.
23163726 septins from the SEPT3 subgroup may be important determinants of polymerization by occupying the terminal position in octameric units which themselves form the building blocks of at least some heterofilaments
21082023 Data show that Septins of the SEPT6 group preferentially interacted with septins of the SEPT2 group, SEPT3 group and SEPT7 group.
15200238 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQS      1 - 70
GLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWE     71 - 140
PIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKAD    141 - 210
TMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGR    211 - 280
KTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVP    281 - 350
ATPCPTAE                                                                  351 - 358
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24787956 2014 In silico docking of forchlorfenuron (FCF) to septins suggests that FCF interferes with GTP binding.
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
23163726 2013 The structure and properties of septin 3: a possible missing link in septin filament formation.
21082023 2010 A draft of the human septin interactome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
More...