Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.28
PubTator Score 3.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UGU5 O75672 O75673 Q9UMT5
Symbols HMG2L1
HMGBCG
THC211630

Gene

Gene RIF (6)

PMID Text
26547506 These results highlight a previously un-reported role of HMGXB4 in the hematopoietic system and transcriptional imbalances of HMGXB4 could contribute to the aberrant expansion of the megakaryocytic lineage in primary myelofibrosis patients
20800603 Observational study of gene-disease association. (HuGE Navigator)
20511232 the first evidence of this novel HMG2L1 molecule playing an important role in attenuating smooth muscle differentiation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17671966 high-mobility group protein 2-like 1 and SNP mapping of a psychotic bipolar affective disorder linkage region on 22q12.3
17671966 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTD      1 - 70
THKKKRKHSSDDYYYGDISSLESSQKKKKKSSPQSTDTAMDLLKAITSPLAAGSKPSKKTGEKSSGSSSH     71 - 140
SESKKEHHRKKVSGSSGELPLEDGGSHKSKKMKPLYVNTETLTLREPDGLKMKLILSPKEKGSSSVDEES    141 - 210
FQYPSQQATVKKSSKKSARDEQGALLLGHELQSFLKTARKKHKSSSDAHSSPGPEGCGSDASQFAESHSA    211 - 280
NLDLSGLEPILVESDSSSGGELEAGELVIDDSYREIKKKKKSKKSKKKKDKEKHKEKRHSKSKRSLGLSA    281 - 350
VPVGEVTVTSGPPPSIPYAGAAAPPLPLPGLHTDGHSEKKKKKEEKDKERERGEKPKKKNMSAYQVFCKE    351 - 420
YRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKA    421 - 490
SSVGVLSPQKKSPPTTMLLPASPAKAPETEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLD    491 - 560
SIICALGPLACLTTQLPELNGCPKQVLSNTLDNIAYIMPGL                                 561 - 601
//

Text Mined References (18)

PMID Year Title
26547506 2016 Integrative analysis of copy number and gene expression data suggests novel pathogenetic mechanisms in primary myelofibrosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20511232 2010 Repression of smooth muscle differentiation by a novel high mobility group box-containing protein, HMG2L1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...