Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.45
PubTator Score 11.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 0.0 3.0

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.714 2.9e-07
ductal carcinoma in situ 1.500 1.2e-02
ependymoma 1.100 3.4e-02
lung adenocarcinoma -1.400 4.5e-06
lung carcinoma -3.200 2.3e-32
non-small cell lung cancer -3.941 2.4e-22
ovarian cancer 1.800 9.9e-03
psoriasis -1.100 2.0e-21

Gene RIF (6)

AA Sequence

MKPALLPWALLLLATALGPGPGPTADAQESCSMRCGALDGPCSCHPTCSGLGTCCLDFRDFCLEILPYSG      1 - 70
SMMGGKDFVVRHFKMSSPTDASVICRFKDSIQTLGHVDSSGQVHCVSPLLYESGRIPFTVSLDNGHSFPR     71 - 140
AGTWLAVHPNKVSMMEKSELVNETRWQYYGTANTSGNLSLTWHVKSLPTQTITIELWGYEETGMPYSQEW    141 - 210
TAKWSYLYPLATHIPNSGSFTFTPKPAPPSYQRWRVGALRIIDSKNYAGQKDVQALWTNDHALAWHLSDD    211 - 280
FREDPVAWARTQCQAWEELEDQLPNFLEELPDCPCTLTQARADSGRFFTDYGCDMEQGSVCTYHPGAVHC    281 - 350
VRSVQASLRYGSGQQCCYTADGTQLLTADSSGGSTPDRGHDWGAPPFRTPPRVPSMSHWLYDVLSFYYCC    351 - 420
LWAPDCPRYMQRRPSNDCRNYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEAALTDLRVQARAQPG    421 - 490
TMSNGTETRGTGLTAVAVQEGNSDVVEVRLANRTGGLEVLLNQEVLSFTEQSWMDLKGMFLSVAAGDRVS    491 - 560
IMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGAN    561 - 630
WTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNFDVAATGSLS    631 - 700
TGTATRVAHQLHQRRMQSLQPVVSCGWLAPPPNGQKEGNRYLAGSTIYFHCDNGYSLAGAETSTCQADGT    701 - 770
WSSPTPKCQPGRSYAVLLGIIFGGLAVVAAVALVYVLLRRRKGNTHVWGAQP                      771 - 822
//

Text Mined References (19)

PMID Year Title