Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.19
PubTator Score 11.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group A ependymoma 2.000 0.000
adrenocortical carcinoma -1.714 0.000
non-small cell lung cancer -3.941 0.000
lung adenocarcinoma -2.700 0.000
psoriasis -1.400 0.000
lung carcinoma -3.200 0.000
ductal carcinoma in situ 1.500 0.012
ovarian cancer 1.800 0.010

Synonym

Accession Q9UGT4 Q9H5Y6
Symbols BK65A6.2

Gene

Gene RIF (3)

PMID Text
25677198 No evidence of association between polymorphisms in SUSD2 and sporadic amyotrophic lateral sclerosis in Han Chinese
23624525 Two new susceptibility loci for amyotrophic lateral sclerosis in the Han Chinese population in chromosome 1, CAMK1G and chromosome 22, SUSD2 and CABIN1.
23131994 Authors found significantly fewer CD4 tumor infiltrating lymphocytes in breast tumors expressing Susd2.

AA Sequence

MKPALLPWALLLLATALGPGPGPTADAQESCSMRCGALDGPCSCHPTCSGLGTCCLDFRDFCLEILPYSG      1 - 70
SMMGGKDFVVRHFKMSSPTDASVICRFKDSIQTLGHVDSSGQVHCVSPLLYESGRIPFTVSLDNGHSFPR     71 - 140
AGTWLAVHPNKVSMMEKSELVNETRWQYYGTANTSGNLSLTWHVKSLPTQTITIELWGYEETGMPYSQEW    141 - 210
TAKWSYLYPLATHIPNSGSFTFTPKPAPPSYQRWRVGALRIIDSKNYAGQKDVQALWTNDHALAWHLSDD    211 - 280
FREDPVAWARTQCQAWEELEDQLPNFLEELPDCPCTLTQARADSGRFFTDYGCDMEQGSVCTYHPGAVHC    281 - 350
VRSVQASLRYGSGQQCCYTADGTQLLTADSSGGSTPDRGHDWGAPPFRTPPRVPSMSHWLYDVLSFYYCC    351 - 420
LWAPDCPRYMQRRPSNDCRNYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEAALTDLRVQARAQPG    421 - 490
TMSNGTETRGTGLTAVAVQEGNSDVVEVRLANRTGGLEVLLNQEVLSFTEQSWMDLKGMFLSVAAGDRVS    491 - 560
IMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGAN    561 - 630
WTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNFDVAATGSLS    631 - 700
TGTATRVAHQLHQRRMQSLQPVVSCGWLAPPPNGQKEGNRYLAGSTIYFHCDNGYSLAGAETSTCQADGT    701 - 770
WSSPTPKCQPGRSYAVLLGIIFGGLAVVAAVALVYVLLRRRKGNTHVWGAQP                      771 - 822
//

Text Mined References (16)

PMID Year Title
25677198 2015 No evidence of association between polymorphisms in four genes and sporadic amyotrophic lateral sclerosis in Han Chinese.
25351403 2014 CSBF/C10orf99, a novel potential cytokine, inhibits colon cancer cell growth through inducing G1 arrest.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23624525 2013 Genome-wide association analyses in Han Chinese identify two new susceptibility loci for amyotrophic lateral sclerosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23131994 2013 Multiple functions of sushi domain containing 2 (SUSD2) in breast tumorigenesis.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...