Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.82
PubTator Score 2.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.600 2.7e-06
atypical teratoid / rhabdoid tumor -1.700 8.6e-07
Breast cancer 1.200 8.7e-09
ependymoma -1.300 4.1e-06
glioblastoma -1.100 3.7e-05
group 3 medulloblastoma -1.100 9.5e-04
medulloblastoma, large-cell -2.300 2.1e-06
osteosarcoma -1.221 8.6e-05
tuberculosis and treatment for 6 months -1.500 3.2e-04

Gene RIF (3)

AA Sequence

MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTSPVIPALERSL      1 - 70
DPDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLGRT     71 - 140
LTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFGSLSLYALGLLLPWRWLAVAGEAPVLIMILL    141 - 210
LSFMPNSPRFLLSRGRDEEALRALAWLRGTDVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVAL    211 - 280
LMRLLQQLTGITPILVYLQSIFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMF    281 - 350
AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLL    351 - 420
MSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTGCCVPETKGRS    421 - 490
LEQIESFFRTGRRSFLR                                                         491 - 507
//

Text Mined References (15)

PMID Year Title