Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.83
PubTator Score 2.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q9UGQ3 A6NNU6 Q5SXD7 Q8NCC2
Symbols GLUT6
GLUT9
HSA011372

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
20734064 Observational study of gene-disease association. (HuGE Navigator)
20413573 Observational study of gene-disease association. (HuGE Navigator)
19554504 The expression pattern of GLUT9 is reported in newly diagnosed esophageal adenocarcinoma by means of immunohistochemistry.

AA Sequence

MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTSPVIPALERSL      1 - 70
DPDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLGRT     71 - 140
LTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFGSLSLYALGLLLPWRWLAVAGEAPVLIMILL    141 - 210
LSFMPNSPRFLLSRGRDEEALRALAWLRGTDVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVAL    211 - 280
LMRLLQQLTGITPILVYLQSIFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMF    281 - 350
AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLL    351 - 420
MSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTGCCVPETKGRS    421 - 490
LEQIESFFRTGRRSFLR                                                         491 - 507
//

Text Mined References (15)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20413573 2010 Association between GLUT9 and gout in Japanese men.
19554504 2009 Expression of hexokinases and glucose transporters in treated and untreated oesophageal adenocarcinoma.
18759275 2008 Association of a common nonsynonymous variant in GLUT9 with serum uric acid levels in old order amish.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17997608 2007 The GLUT9 gene is associated with serum uric acid levels in Sardinia and Chianti cohorts.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...