Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.10
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.200 4.4e-04
intraductal papillary-mucinous carcinoma... 1.200 3.8e-04
osteosarcoma 1.399 3.4e-07
psoriasis 1.500 2.5e-04

AA Sequence

MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFI      1 - 70
LLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSAL     71 - 140
GKKGDAISYARIQQQRQQADEEKLAETLEGEL                                          141 - 172
//

Text Mined References (11)

PMID Year Title