Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.10
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.41512420821752E-7
psoriasis 6685 2.5104835300467E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.82559614835331E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.39084374367086E-4

Expression

  Differential Expression (4)

Synonym

Accession Q9UGQ2 B7Z3T8 B7Z5E1 F5GXX4 Q5SXD4 Q8NBM6
Symbols C9orf7
FLOWER
D9S2135

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard EggNOG Inparanoid

AA Sequence

MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFI      1 - 70
LLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSAL     71 - 140
GKKGDAISYARIQQQRQQADEEKLAETLEGEL                                          141 - 172
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19737521 2009 A synaptic vesicle-associated Ca2+ channel promotes endocytosis and couples exocytosis to endocytosis.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...