Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.10
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

AA Sequence

MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFI      1 - 70
LLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSAL     71 - 140
GKKGDAISYARIQQQRQQADEEKLAETLEGEL                                          141 - 172
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19737521 2009 A synaptic vesicle-associated Ca2+ channel promotes endocytosis and couples exocytosis to endocytosis.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...