Property Summary

NCBI Gene PubMed Count 73
Grant Count 122
R01 Count 85
Funding $16,507,370.99
PubMed Score 650.42
PubTator Score 134.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.034 0.001

Synonym

Accession Q9UGP5 D3DR76 Q5JQP5 Q6NUM2 Q9BTN8 Q9HA10 Q9HB35 Pol Lambda
Symbols BETAN
POLKAPPA

Gene

PDB

1NZP   1RZT   1XSL   1XSN   1XSP   2BCQ   2BCR   2BCS   2BCU   2BCV   2GWS   2JW5   2PFN   2PFO   2PFP   2PFQ   3C5F   3C5G   3HW8   3HWT   3HX0   3MDA   3MDC   3MGH   3MGI   3PML   3PMN   3PNC   3UPQ   3UQ0   3UQ2   4FO6   4K4G   4K4H   4K4I   4X5V   4XA5   4XQ8   4XRH   4XUS   5CA7   5CB1   5CHG   5CJ7   5CP2   5CR0   5CWR   5DDM   5DDY   5DKW   5III   5IIJ   5IIK   5IIL   5IIM   5IIN   5IIO  

 GO Component (2)

Gene RIF (58)

PMID Text
26917111 Pol beta, to a greater extent than Pol lambda can incorporate rNMPs opposite normal bases or 8-oxo-G, and with a different fidelity. Further, the incorporation of rNMPs opposite 8-oxo-G delays repair by DNA glycosylases.
25741586 pol lambda is responsible for a significant fraction of Fapy.dG-induced G --> T mutations.
25687118 Fen1 significantly stimulated trinucleotide repeats expansion by Pol beta, but not by the related enzyme Pol lambda.
25460917 DNA polymerase lamda catalyzes lesion bypass across benzo[a]pyrene-derived DNA adducts.
25015085 Structural basis for the binding and incorporation of nucleotide analogs with L-stereochemistry by human DNA polymerase lambda.
23935073 A specific N-terminal extension of the 8 kDa domain of DNA polymerase lambda is important for the non-homologous end joining function.
23330920 Inactivation of polymerase (DNA directed) lambda lyase activity by 5'-(2-phosphoryl-1,4-dioxobutane prevents the enzyme from conducting polymerization following preincubation of the protein and DNA.
23118481 The results provides evidence that DNA pol lambda is required for cell cycle progression and is functionally connected to the S phase DNA damage response machinery in cancer cells.
22584622 A structural study shows how a ribonucleotide can be accommodated in the DNA polymerase lambda active site.
22373917 Results reveal that DNA pol lambda and DNA ligase I are sufficient to promote efficient microhomology-mediated end-joining repair of broken DNA ends in vitro.
More...

AA Sequence

MDPRGILKAFPKRQKIHADASSKVLAKIPRREEGEEAEEWLSSLRAHVVRTGIGRARAELFEKQIVQHGG      1 - 70
QLCPAQGPGVTHIVVDEGMDYERALRLLRLPQLPPGAQLVKSAWLSLCLQERRLVDVAGFSIFIPSRYLD     71 - 140
HPQPSKAEQDASIPPGTHEALLQTALSPPPPPTRPVSPPQKAKEAPNTQAQPISDDEASDGEETQVSAAD    141 - 210
LEALISGHYPTSLEGDCEPSPAPAVLDKWVCAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYA    211 - 280
KAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQ    281 - 350
MWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR    351 - 420
GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLPGPGRRHRRLD    421 - 490
IIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVF    491 - 560
RLLGLPYREPAERDW                                                           561 - 575
//

Text Mined References (74)

PMID Year Title
26917111 2016 Impact of ribonucleotide incorporation by DNA polymerases ? and ? on oxidative base excision repair.
25741586 2015 Unlike catalyzing error-free bypass of 8-oxodGuo, DNA polymerase ? is responsible for a significant part of Fapy·dG-induced G ? T mutations in human cells.
25687118 2015 Expansion of CAG triplet repeats by human DNA polymerases ? and ? in vitro, is regulated by flap endonuclease 1 and DNA ligase 1.
25460917 2014 Human DNA polymerases catalyze lesion bypass across benzo[a]pyrene-derived DNA adduct clustered with an abasic site.
25416956 2014 A proteome-scale map of the human interactome network.
25015085 2014 Structural basis for the binding and incorporation of nucleotide analogs with L-stereochemistry by human DNA polymerase ?.
23935073 2013 A specific N-terminal extension of the 8 kDa domain is required for DNA end-bridging by human Pol? and Pol?.
23330920 2013 DNA polymerase ? inactivation by oxidized abasic sites.
23118481 2013 Silencing of human DNA polymerase ? causes replication stress and is synthetically lethal with an impaired S phase checkpoint.
22584622 2012 The catalytic cycle for ribonucleotide incorporation by human DNA Pol ?.
More...