Property Summary

NCBI Gene PubMed Count 26
PubMed Score 15.14
PubTator Score 14.37

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UGP4 Q17RQ1 Q9BQQ9 Q9NQ47
Symbols

Gene

Gene RIF (14)

PMID Text
25940947 Thus, the LIMD1-MYBL1 Index had considerable clinical value for DLBCL subtype classification and prognosis.
25127217 Cyclic stretch is associated with a JNK-dependent increase in binding of a LATS inhibitor, LIMD1, to the LATS1 kinase and that reduction of LIMD1 expression suppresses the activation of YAP by cyclic stretch.
24523249 LIMD1 prevents retinoblastoma phosphorylation and downregulates of E2F1 protein and blocks entry of cells into S-phase.
22286099 Data show that the tumour suppressor protein LIMD1 acts as a molecular scaffold, simultaneously binding the PHDs and VHL, thereby assembling a PHD-LIMD1-VHL protein complex and creating an enzymatic niche that enables efficient degradation of HIF-1alpha.
22190034 HIV-1 PR is identified to have a physical interaction with LIM domains containing 1 (LIMD1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 PR is identified to have a physical interaction with LIM domains containing 1 (LIMD1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21402070 PU.1 is a major transcriptional activator of LIMD1
20226061 LIMD1 inactivation as primary event than inactivation of RB1 in head and neck squamous cell carcinoma development.
20226061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19060205 LIMD1 is a validated chromosome 3p21.3 tumor-suppressor gene involved in human lung cancer development.
More...

AA Sequence

MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQQQQLLQEETL      1 - 70
PRGSRGPVNGGGRLGPQARWEVVGSKLTVDGAAKPPLAASTGAPGAVTTLAAGQPPYPPQEQRSRPYLHG     71 - 140
TRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYYDNLSLASPKWGDKPGVSPSIGLSVGSGWPS    141 - 210
SPGSDPPLPKPCGDHPLNHRQLSLSSSRSSEGSLGGQNSGIGGRSSEKPTGLWSTASSQRVSPGLPSPNL    211 - 280
ENGAPAVGPVQPRTPSVSAPLALSCPRQGGLPRSNSGLGGEVSGVMSKPNVDPQPWFQDGPKSYLSSSAP    281 - 350
SSSPAGLDGSQQGAVPGLGPKPGCTDLGTGPKLSPTSLVHPVMSTLPELSCKEGPLGWSSDGSLGSVLLD    351 - 420
SPSSPRVRLPCQPLVPGPELRPSAAELKLEALTQRLEREMDAHPKADYFGACVKCSKGVFGAGQACQAMG    421 - 490
NLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGC    491 - 560
FRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECYHC    561 - 630
EDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEKRPSSTALHQHHF                            631 - 676
//

Text Mined References (34)

PMID Year Title
25940947 2015 Identification and validation of a two-gene expression index for subtype classification and prognosis in Diffuse Large B-Cell Lymphoma.
25127217 2014 Regulation of YAP by mechanical strain through Jnk and Hippo signaling.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24523249 2014 LIMD1 antagonizes E2F1 activity and cell cycle progression by enhancing Rb function in cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22286099 2012 The LIMD1 protein bridges an association between the prolyl hydroxylases and VHL to repress HIF-1 activity.
22190034 2011 Global landscape of HIV-human protein complexes.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...