Property Summary

NCBI Gene PubMed Count 27
PubMed Score 16.36
PubTator Score 14.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.069 2.0e-02
adult high grade glioma 1.200 2.4e-04
astrocytoma 1.400 1.5e-13
Astrocytoma, Pilocytic 1.300 8.1e-07
atypical teratoid / rhabdoid tumor 1.600 4.5e-07
ependymoma 1.200 2.6e-02
glioblastoma 1.200 4.3e-06
group 3 medulloblastoma 1.100 1.7e-02
intraductal papillary-mucinous carcinoma... 1.100 5.7e-03
juvenile dermatomyositis 1.004 6.4e-10
lung carcinoma -1.900 3.8e-25
medulloblastoma, large-cell 1.400 9.7e-05
non-small cell lung cancer -1.059 7.1e-13
oligodendroglioma 1.400 4.2e-02
osteosarcoma 1.060 4.7e-04
ovarian cancer 1.100 2.5e-03
primitive neuroectodermal tumor 1.200 7.9e-05
spina bifida 1.226 3.4e-02
subependymal giant cell astrocytoma 1.572 2.5e-02

Gene RIF (14)

AA Sequence

MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQQQQLLQEETL      1 - 70
PRGSRGPVNGGGRLGPQARWEVVGSKLTVDGAAKPPLAASTGAPGAVTTLAAGQPPYPPQEQRSRPYLHG     71 - 140
TRHGSQDCGSRESLATSEMSAFHQPGPCEDPSCLTHGDYYDNLSLASPKWGDKPGVSPSIGLSVGSGWPS    141 - 210
SPGSDPPLPKPCGDHPLNHRQLSLSSSRSSEGSLGGQNSGIGGRSSEKPTGLWSTASSQRVSPGLPSPNL    211 - 280
ENGAPAVGPVQPRTPSVSAPLALSCPRQGGLPRSNSGLGGEVSGVMSKPNVDPQPWFQDGPKSYLSSSAP    281 - 350
SSSPAGLDGSQQGAVPGLGPKPGCTDLGTGPKLSPTSLVHPVMSTLPELSCKEGPLGWSSDGSLGSVLLD    351 - 420
SPSSPRVRLPCQPLVPGPELRPSAAELKLEALTQRLEREMDAHPKADYFGACVKCSKGVFGAGQACQAMG    421 - 490
NLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGC    491 - 560
FRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECYHC    561 - 630
EDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEKRPSSTALHQHHF                            631 - 676
//

Text Mined References (35)

PMID Year Title