Property Summary

NCBI Gene PubMed Count 35
Grant Count 25
R01 Count 16
Funding $1,854,699.77
PubMed Score 86.87
PubTator Score 66.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 0.002
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.300 0.002
medulloblastoma, large-cell -1.400 0.000
lung cancer 2.200 0.001
adult high grade glioma -1.300 0.000
subependymal giant cell astrocytoma -1.117 0.010
ovarian cancer 1.700 0.000

Gene RIF (23)

PMID Text
26704974 Our study differentiates the functions of PARP-2 domains from those of PARP-1, the other major DDR-PARP, and highlights the specialization of the multi-domain architectures of DDR-PARPs.
26674097 Our data suggest for the first time that a SNP in PARP2, rs878156, may together with other genetic variants modulate cancer specific survival in breast cancer patients depending on chemotherapy
26673720 The initial affinity between the PARP1, PARP2 and the DNA damaged site appears to influence both the size of the Poly(ADP-Ribose) synthesized and the time of residence of PARylated PARP1 and PARP2 on DNA damages.
26513298 Data show that E7449 represents a dual Poly(ADP-ribose) Polymerase 1/2 and tankyrase 1/2 inhibitor which has the advantage of targeting Wnt/beta-catenin signaling addicted tumors.
25800440 Identification of ADP-ribosylation sites in PARP2 and the determination of the extent ofpoly(ADP-ribosyl)ated residues in this protein was performed.
25724268 Interaction of PARP-2 with AP site containing DNA
25133494 Nuclear Smad function is negatively regulated by PARP-1 that is assisted by PARP-2 and positively regulated by PARG during the course of TGFB signaling.
24365238 the depletion of PARP-2 leads to lower HDL levels which represent a risk factor to cardiovascular diseases.
23291187 these findings propose a novel mechanism of PARP-2 in transcriptional regulation involving specific protein-protein interactions and highlight the importance of PARP-2 in the regulation of cell cycle progression.
21577210 PARP-1 (but not PARP-2) poly(ADP) ribosylates Snail1, both in vivo and in vitro, and interacts with Snail1, an association that is sensitive to PARP inhibitors.
More...

AA Sequence

MAARRRRSTGGGRARALNESKRVNNGNTAPEDSSPAKKTRRCQRQESKKMPVAGGKANKDRTEDKQDGMP      1 - 70
GRSWASKRVSESVKALLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDD     71 - 140
AQRNFSVWMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMDYAT    141 - 210
NTQDEEETKKEESLKSPLKPESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQ    211 - 280
SLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEIAIKLVKTE    281 - 350
LQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAFREDL    351 - 420
HNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEV    421 - 490
ALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYI    491 - 560
VYNPNQVRMRYLLKVQFNFLQLW                                                   561 - 583
//

Text Mined References (38)

PMID Year Title
27067600 2016 HPF1/C4orf27 Is a PARP-1-Interacting Protein that Regulates PARP-1 ADP-Ribosylation Activity.
26704974 2016 PARP-2 domain requirements for DNA damage-dependent activation and localization to sites of DNA damage.
26674097 2015 A polymorphism in the base excision repair gene PARP2 is associated with differential prognosis by chemotherapy among postmenopausal breast cancer patients.
26673720 2016 Single molecule detection of PARP1 and PARP2 interaction with DNA strand breaks and their poly(ADP-ribosyl)ation using high-resolution AFM imaging.
26513298 2015 E7449: A dual inhibitor of PARP1/2 and tankyrase1/2 inhibits growth of DNA repair deficient tumors and antagonizes Wnt signaling.
25800440 2015 Quantitative site-specific ADP-ribosylation profiling of DNA-dependent PARPs.
25724268 2015 Interaction of PARP-2 with AP site containing DNA.
25133494 2014 Fine-tuning of Smad protein function by poly(ADP-ribose) polymerases and poly(ADP-ribose) glycohydrolase during transforming growth factor ? signaling.
24365238 2014 Deletion of PARP-2 induces hepatic cholesterol accumulation and decrease in HDL levels.
23291187 2013 PARP-2 regulates cell cycle-related genes through histone deacetylation and methylation independently of poly(ADP-ribosyl)ation.
More...