Property Summary

NCBI Gene PubMed Count 15
PubMed Score 121.53
PubTator Score 20.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
invasive ductal carcinoma -1.078 5.7e-03
medulloblastoma, large-cell 1.100 2.7e-02
osteosarcoma -1.229 1.1e-03
ovarian cancer 1.100 7.5e-03
posterior fossa group B ependymoma 1.200 5.2e-06
psoriasis -1.300 1.3e-04
tuberculosis -1.500 1.2e-05

Gene RIF (6)

AA Sequence

MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVL      1 - 70
YSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLH     71 - 140
QWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESI    141 - 210
LTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHA    211 - 280
AVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVC    281 - 350
QEVKKLVGFL                                                                351 - 360
//

Text Mined References (19)

PMID Year Title