Property Summary

NCBI Gene PubMed Count 12
Grant Count 52
R01 Count 36
Funding $17,258,086.41
PubMed Score 115.63
PubTator Score 20.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma -1.229 0.001
medulloblastoma, large-cell 1.100 0.027
tuberculosis -1.500 0.000
posterior fossa group B ependymoma 1.200 0.000
invasive ductal carcinoma -1.078 0.006
ovarian cancer 1.100 0.008

Gene RIF (4)

PMID Text
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
17726052 Mutations located at the appended beta1-beta2 hairpin and the AIDQ sequence of human TrpRS switch this enzyme to a tRNA-dependent mode in the tryptophan activation step.
14757836 tandem promoters provide a dual system to regulate expression and alternative splicing of human TrpRS in vivo

AA Sequence

MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWVRLQDEYDSVL      1 - 70
YSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEHTQLSWILSCMVRLPRLQHLH     71 - 140
QWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQGFNKKYGEFFPVPESI    141 - 210
LTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHA    211 - 280
AVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVC    281 - 350
QEVKKLVGFL                                                                351 - 360
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17726052 2007 Human tryptophanyl-tRNA synthetase is switched to a tRNA-dependent mode for tryptophan activation by mutations at V85 and I311.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14757836 2004 A new gamma-interferon-inducible promoter and splice variants of an anti-angiogenic human tRNA synthetase.
More...