Property Summary

NCBI Gene PubMed Count 15
PubMed Score 44.61
PubTator Score 9.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Disease Target Count
Spontaneous abortion 113
Disease Target Count P-value
cutaneous lupus erythematosus 1057 4.1e-03
rhinitis with controlled asthma 8 1.4e-02

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 4.1e-03
rhinitis with controlled asthma 1.600 1.4e-02

Gene RIF (7)

AA Sequence

MGLLLPLALCILVLCCGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDA      1 - 70
QEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAIFYMNNPSRVLYLAAYNCTLR     71 - 140
PVSKKKIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYL    141 - 210
IKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPK    211 - 280
VEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPME    281 - 350
EKLVVLPFPKEKARTAECPGPAQNASPLVLPP                                          351 - 382
//

Text Mined References (19)

PMID Year Title