Property Summary

NCBI Gene PubMed Count 13
PubMed Score 33.82
PubTator Score 9.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
rhinitis with controlled asthma 1.600 0.014
uncontrolled asthma 3.200 0.001
cutaneous lupus erythematosus 1.800 0.004

Gene RIF (5)

PMID Text
25671698 Data indicate that fetuin-B was one of the highly expressed serum proteins in acute myocardial infarction.
22739111 Reduced expression of fetuin-b led to a significant increase in the expression of lipogenic genes, thereby resulting in higher lipid levels.
16797392 results support the hypothesis that fetuin-A serum levels are associated with bone cell activity
15280384 serum fetuin has a role in processing and transport of matrix gamma-carboxyglutamic acid protein and bone morphogenetic protein-2 in cultured human vascular smooth muscle cells
1284814 HIV-1 gp160 binds to the natural glycoprotein fetuin

AA Sequence

MGLLLPLALCILVLCCGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDA      1 - 70
QEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAIFYMNNPSRVLYLAAYNCTLR     71 - 140
PVSKKKIYMTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYL    141 - 210
IKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPK    211 - 280
VEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPME    281 - 350
EKLVVLPFPKEKARTAECPGPAQNASPLVLPP                                          351 - 382
//

Text Mined References (17)

PMID Year Title
25671698 2015 The serum protein fetuin-B is involved in the development of acute myocardial infarction.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23562279 2013 Fetuin-B, a liver-derived plasma protein is essential for fertilization.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22739111 2012 Downregulation of fetuin-B and zinc-?2-glycoprotein is linked to impaired fatty acid metabolism in liver cells.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
16797392 2006 Renal osteodystrophy: alpha-Heremans Schmid glycoprotein/fetuin-A, matrix GLA protein serum levels, and bone histomorphometry.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15499407 2004 Identification of Fetuin-B as a member of a cystatin-like gene family on mouse chromosome 16 with tumor suppressor activity.
More...