Property Summary

NCBI Gene PubMed Count 86
Grant Count 83
R01 Count 74
Funding $10,431,643.76
PubMed Score 235.75
PubTator Score 221.53

Knowledge Summary

Patent

No data available

Expression

Gene

PANTHER Protein Class (3)

Gene RIF (80)

PMID Text
26542257 The DMBT1 may play a role in epithelial differentiation and local innate immunity during neonatal inflammatory bowel processes.
26172445 Gp340 expression patterns at these sites were also distinct.
25885541 Data indicate that DMBT1 promotes VEGF and suppresses IL-6 production in alveolar tissues, which could point to DMBT1 having a possible role in the transition from inflammation to regeneration.
25848046 multiallelic copy number variation (CNV) within DMBT1 is extensive across all populations.
25320275 gp340 exhibits varying functions in the different mucosal locations.
24923446 Oral streptococci adhere to tooth-immobilized glycoprotein 340 (GP340) via the surface protein antigen I/II as the first step in pathogenesis. Calcium increases the conformational stability of the scavenger-rich cysteine repeat domains of GP340.
24223725 A novel functional role of rs2981804 in regulating DMBT1 expression.
23815775 Aalanine substitution scan reveals amino acids D34, D35, N96, and E101 in gp340 are the critical residues interaction with HIV-1 gp120
23815775 Aalanine substitution scan reveals amino acids D34, D35, N96, and E101 in gp340 are the critical residues interaction with HIV-1 gp120
23815775 Aalanine substitution scan reveals amino acids D34, D35, N96, and E101 in gp340 are the critical residues interaction with HIV-1 gp120
More...

AA Sequence

MGISTVILEMCLLWGQVLSTGGWIPRTTDYASLIPSEVPLDPTVAEGSPFPSESTLESTVAEGSPISLES      1 - 70
TLESTVAEGSLIPSESTLESTVAEGSDSGLALRLVNGDGRCQGRVEILYRGSWGTVCDDSWDTNDANVVC     71 - 140
RQLGCGWAMSAPGNAWFGQGSGPIALDDVRCSGHESYLWSCPHNGWLSHNCGHGEDAGVICSAAQPQSTL    141 - 210
RPESWPVRISPPVPTEGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWA    211 - 280
MSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLTHNCGHSEDAGVICSAPQSRPTPSPDTWPTS    281 - 350
HASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQ    351 - 420
GSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTITLPASTVGSES    421 - 490
SLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPGNARFGQGSGPIVLDD    491 - 560
VRCSGNESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDS    561 - 630
WDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPNNGWLSHNCGHHEDAGVI    631 - 700
CSAAQSRSTPRPDTLSTITLPPSTVGSESSLTLRLVNGSDRCQGRVEVLYRGSWGTVCDDSWDTNDANVV    701 - 770
CRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSVSQSRPT    771 - 840
PSPDTWPTSHASTAGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLGCGWATS    841 - 910
APGNARFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCQHSEDAGVICSAAHSWSTPSPDTLPTITL    911 - 980
PASTVGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMSAPGNARFGQ    981 - 1050
GSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHSEDAGVICSASQSRPTPSPDTWPTSHASTAGSESSL   1051 - 1120
ALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWAMSAPGNARFGQGSGPIVLDDVR   1121 - 1190
CSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRC   1191 - 1260
QGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSC   1261 - 1330
PHNGWLSHNCGHHEDAGVICSASQSQPTPSPDTWPTSHASTAGSESSLALRLVNGGDRCQGRVEVLYRGS   1331 - 1400
WGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCG   1401 - 1470
HHEDAGVICSASQSQPTPSPDTWPTSRASTAGSESTLALRLVNGGDRCRGRVEVLYQGSWGTVCDDYWDT   1471 - 1540
NDANVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSA   1541 - 1610
AQSQSTPRPDTWLTTNLPALTVGSESSLALRLVNGGDRCRGRVEVLYRGSWGTVCDDSWDTNDANVVCRQ   1611 - 1680
LGCGWAMSAPGNARFGQGSGPIVLDDVRCSGNESYLWSCPHKGWLTHNCGHHEDAGVICSATQINSTTTD   1681 - 1750
WWHPTTTTTARPSSNCGGFLFYASGTFSSPSYPAYYPNNAKCVWEIEVNSGYRINLGFSNLKLEAHHNCS   1751 - 1820
FDYVEIFDGSLNSSLLLGKICNDTRQIFTSSYNRMTIHFRSDISFQNTGFLAWYNSFPSDATLRLVNLNS   1821 - 1890
SYGLCAGRVEIYHGGTWGTVCDDSWTIQEAEVVCRQLGCGRAVSALGNAYFGSGSGPITLDDVECSGTES   1891 - 1960
TLWQCRNRGWFSHNCNHREDAGVICSGNHLSTPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPN   1961 - 2030
NAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGARGSFTSSSNFMSIRFI   2031 - 2100
SDHSITRRGFRAEYYSSPSNDSTNLLCLPNHMQASVSRSYLQSLGFSASDLVISTWNGYYECRPQITPNL   2101 - 2170
VIFTIPYSGCGTFKQADNDTIDYSNFLTAAVSGGIIKRRTDLRIHVSCRMLQNTWVDTMYIANDTIHVAN   2171 - 2240
NTIQVEEVQYGNFDVNISFYTSSSFLYPVTSRPYYVDLNQDLYVQAEILHSDAVLTLFVDTCVASPYSND   2241 - 2310
FTSLTYDLIRSGCVRDDTYGPYSSPSLRIARFRFRAFHFLNRFPSVYLRCKMVVCRAYDPSSRCYRGCVL   2311 - 2380
RSKRDVGSYQEKVDVVLGPIQLQTPPRREEEPR                                        2381 - 2413
//

Text Mined References (92)

PMID Year Title
26542257 2016 Elevated DMBT1 levels in neonatal gastrointestinal diseases.
26172445 2015 Periluminal Distribution of HIV-Binding Target Cells and Gp340 in the Oral, Cervical and Sigmoid/Rectal Mucosae: A Mapping Study.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25885541 2015 Deleted in malignant brain tumors 1 (DMBT1) elicits increased VEGF and decreased IL-6 production in type II lung epithelial cells.
25848046 2015 Evolution of the rapidly mutating human salivary agglutinin gene (DMBT1) and population subsistence strategy.
25320275 2014 The salivary scavenger and agglutinin in early life: diverse roles in amniotic fluid and in the infant intestine.
24923446 2014 The calcium-induced conformation and glycosylation of scavenger-rich cysteine repeat (SRCR) domains of glycoprotein 340 influence the high affinity interaction with antigen I/II homologs.
24223725 2013 Intestinal DMBT1 expression is modulated by Crohn's disease-associated IL23R variants and by a DMBT1 variant which influences binding of the transcription factors CREB1 and ATF-2.
23691218 2013 A variant form of the human deleted in malignant brain tumor 1 (DMBT1) gene shows increased expression in inflammatory bowel diseases and interacts with dimeric trefoil factor 3 (TFF3).
23218398 Cardiac amyloidosis induces up-regulation of Deleted in Malignant Brain Tumors 1 (DMBT1).
More...