Property Summary

NCBI Gene PubMed Count 33
Grant Count 1
Funding $8,498.5
PubMed Score 8.30
PubTator Score 10.13

Knowledge Summary

Patent (428)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 2.600 0.000
cutaneous lupus erythematosus 1.900 0.003
glioblastoma 3.200 0.010
atypical teratoid / rhabdoid tumor 2.600 0.012
pediatric high grade glioma 2.900 0.001

Synonym

Accession Q9UGM1 Q14CY7 Q4W5A2 Q9NYV2
Symbols NACHRA9
HSA243342

Gene

 Grant Application (1)

PDB

4D01   4UXU   4UY2  

Gene RIF (19)

PMID Text
25450229 The rare variants in CHRNA9 were significantly associated with smoking status.
25142973 Our findings support a significant interaction effect existing between the CHRNA9 gene and smoking exposure on the risk of breast cancer development.
24676996 CHRNA9 polymorphisms are associated with non-small cell lung cancer.
22774872 A two order of magnitude species difference in potency of alpha-conotoxin RgIA is reported for rat versus human alpha9alpha10 nAChR.
22280835 Thia case-control analysis revealed that an increased risk of lung cancer is associated with two SNPs in CHRNA9, rs56159866 and rs6819385.
22125646 Data suggest that the biologic activities of Alpha9 nicotinic receptor (CHRNA9) may be regulated at the splicing level, and genetic polymorphisms in CHRNA9 affecting protein levels, amino acid sequence and RNA splicing may influence the risk for lung cancer.
21370452 Significant increases in the alpha9-nAChR mRNA and protein levels in MCF-7 cells were detected 6 h after nicotine treatment. Nicotine- and estrogen-induced alpha9-nicotinic acetylcholine receptor upregulation was blocked by (-)-epigallocatechin-3-gallate.
20953833 Estrogen receptor-alpha plays a central role in mediating alpha9-nAChR gene up-regulation in response to either nicotine or estradiol stimulation.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20733118 The alpha9-nAChR is important for nicotine-induced transformation of normal human breast epithelial cells. Results imply that receptor-mediated carcinogenic signals play a decisive role in biological functions related to human breast cancer development.
More...

AA Sequence

MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDM      1 - 70
DERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYD     71 - 140
GLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPA    141 - 210
VKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMT    211 - 280
VFQLMVAEIMPASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLF    281 - 350
VYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQ    351 - 420
YKVLTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD               421 - 479
//

Text Mined References (33)

PMID Year Title
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
25282151 2014 Crystal structures of free and antagonist-bound states of human ?9 nicotinic receptor extracellular domain.
25142973 2014 CHRNA9 polymorphisms and smoking exposure synergize to increase the risk of breast cancer in Taiwan.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24676996 2014 Neuronal acetylcholine receptor subunit alpha-9 (CHRNA9) polymorphisms are associated with NSCLC risk in a Chinese population.
22774872 2012 Molecular basis for the differential sensitivity of rat and human ?9?10 nAChRs to ?-conotoxin RgIA.
22280835 2012 New associations of the genetic polymorphisms in nicotinic receptor genes with the risk of lung cancer.
22125646 2011 Naturally occurring variants of human ?9 nicotinic receptor differentially affect bronchial cell proliferation and transformation.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21370452 2011 Tea polyphenol (-)-epigallocatechin-3-gallate inhibits nicotine- and estrogen-induced ?9-nicotinic acetylcholine receptor upregulation in human breast cancer cells.
More...