Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.00
PubTator Score 3.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -5.200 0.018
psoriasis 2.000 0.009
Atopic dermatitis -3.300 0.000
diabetes mellitus 1.100 0.002
cystic fibrosis 2.500 0.000
nasopharyngeal carcinoma -1.400 0.009
non-inflammatory breast cancer -1.400 0.033

AA Sequence

MSSQQSAVSAKGFSKGSSQGPAPCPAPAPTPAPASSSSCCGSGRGCCGDSGCCGSSSTSCCCFPRRRRRQ      1 - 70
RSSGCCCCGGGSQRSQRSNNRSSGCCSGC                                              71 - 99
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21804549 2011 Meta-analysis of genome-wide association studies of asthma in ethnically diverse North American populations.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230159 2001 Identification of human epidermal differentiation complex (EDC)-encoded genes by subtractive hybridization of entire YACs to a gridded keratinocyte cDNA library.