Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.00
PubTator Score 3.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis -3.300 4.6e-05
cystic fibrosis 2.500 7.1e-05
diabetes mellitus 1.100 2.4e-03
esophageal adenocarcinoma -5.200 1.8e-02
inflammatory breast cancer -1.200 2.1e-02
nasopharyngeal carcinoma -1.400 9.5e-03
psoriasis 1.300 7.6e-04

Gene RIF (1)

AA Sequence

MSSQQSAVSAKGFSKGSSQGPAPCPAPAPTPAPASSSSCCGSGRGCCGDSGCCGSSSTSCCCFPRRRRRQ      1 - 70
RSSGCCCCGGGSQRSQRSNNRSSGCCSGC                                              71 - 99
//

Text Mined References (9)

PMID Year Title