Property Summary

NCBI Gene PubMed Count 21
PubMed Score 135.49
PubTator Score 9.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 9.78605634728505E-13
lung adenocarcinoma 2714 6.11657529793236E-9
malignant mesothelioma 3163 1.15740316885259E-6
ulcerative colitis 2087 1.52797850067069E-5
interstitial cystitis 2299 0.00118180035993905
ductal carcinoma in situ 1745 0.00157634071162197
lung cancer 4473 0.00184464183544141
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.003543170328348
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0112324115617824
group 3 medulloblastoma 2254 0.0122926867078355
spina bifida 1064 0.0226439600247717
fibroadenoma 557 0.0322511619893185

Expression

  Differential Expression (12)

Synonym

Accession Q9UGK3 A6NKK3 Q9NXI2 STAP-2
Symbols BKS

Gene

PANTHER Protein Class (2)

PDB

2EL8  

  Ortholog (6)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (12)

PMID Text
23700042 STAP2 is upregulated in uterosacral ligaments in pelvic organ prolapse
22611243 STAP-2 is a novel participant in the regulation of T cell apoptosis after stimulation
22231445 Our results demonstrate a critical contribution of STAP-2 in BCR-ABL activity.
20929863 Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19933863 STAP-2 expression in Jurkat T cells affects migration following stromal cell-derived factor-1alpha (SDF-1alpha) treatment; STAP-2 association with Vav1, the guanine-nucleotide exchanging factor for Rac1, enhances downstream Vav1/Rac1 signaling.
19401194 These results indicate that Cbl regulates STAP-2 protein levels and Brk/STAP-2-mediated STAT3 activation.
19393627 STAP-2 is phosphorylated at Tyr250 by Brk, and plays an important role in Brk-mediated STAT3 activation.
18573890 These results suggest that STAP-2 acts as an endogenous negative regulator of Epstein-Barr virus LMP1-mediated signaling through TRAF3 and TRADD.
17675501 STAP-2 associates with FAK and enhances its degradation, proteasome inhibitors block FAK degradation, and STAP-2 recruits an endogenous E3 ubiquitin ligase, Cbl, to FAK.
More...

AA Sequence

MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEK      1 - 70
LTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLA     71 - 140
KEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREG    141 - 210
PKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAP    211 - 280
CTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPK    281 - 350
PPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH                     351 - 403
//

Text Mined References (22)

PMID Year Title
23700042 2013 Estrogen-related genome-based expression profiling study of uterosacral ligaments in women with pelvic organ prolapse.
22611243 2012 Signal-transducing adaptor protein-2 modulates Fas-mediated T cell apoptosis by interacting with caspase-8.
22231445 2012 STAP-2 interacts with and modulates BCR-ABL-mediated tumorigenesis.
20929863 2010 Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19933863 2009 Signal-transducing adaptor protein-2 regulates stromal cell-derived factor-1 alpha-induced chemotaxis in T cells.
19401194 2009 The protein content of an adaptor protein, STAP-2 is controlled by E3 ubiquitin ligase Cbl.
19393627 2009 STAP-2 is phosphorylated at tyrosine-250 by Brk and modulates Brk-mediated STAT3 activation.
18573890 2008 STAP-2 negatively regulates both canonical and noncanonical NF-kappaB activation induced by Epstein-Barr virus-derived latent membrane protein 1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...