Property Summary

NCBI Gene PubMed Count 21
Grant Count 37
R01 Count 17
Funding $4,582,744.38
PubMed Score 135.49
PubTator Score 9.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (12)

PMID Text
23700042 STAP2 is upregulated in uterosacral ligaments in pelvic organ prolapse
22611243 STAP-2 is a novel participant in the regulation of T cell apoptosis after stimulation
22231445 Our results demonstrate a critical contribution of STAP-2 in BCR-ABL activity.
20929863 Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19933863 STAP-2 expression in Jurkat T cells affects migration following stromal cell-derived factor-1alpha (SDF-1alpha) treatment; STAP-2 association with Vav1, the guanine-nucleotide exchanging factor for Rac1, enhances downstream Vav1/Rac1 signaling.
19401194 These results indicate that Cbl regulates STAP-2 protein levels and Brk/STAP-2-mediated STAT3 activation.
19393627 STAP-2 is phosphorylated at Tyr250 by Brk, and plays an important role in Brk-mediated STAT3 activation.
18573890 These results suggest that STAP-2 acts as an endogenous negative regulator of Epstein-Barr virus LMP1-mediated signaling through TRAF3 and TRADD.
17675501 STAP-2 associates with FAK and enhances its degradation, proteasome inhibitors block FAK degradation, and STAP-2 recruits an endogenous E3 ubiquitin ligase, Cbl, to FAK.
More...

AA Sequence

MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEK      1 - 70
LTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLA     71 - 140
KEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREG    141 - 210
PKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAP    211 - 280
CTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPK    281 - 350
PPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH                     351 - 403
//

Text Mined References (22)

PMID Year Title
23700042 2013 Estrogen-related genome-based expression profiling study of uterosacral ligaments in women with pelvic organ prolapse.
22611243 2012 Signal-transducing adaptor protein-2 modulates Fas-mediated T cell apoptosis by interacting with caspase-8.
22231445 2012 STAP-2 interacts with and modulates BCR-ABL-mediated tumorigenesis.
20929863 2010 Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19933863 2009 Signal-transducing adaptor protein-2 regulates stromal cell-derived factor-1 alpha-induced chemotaxis in T cells.
19401194 2009 The protein content of an adaptor protein, STAP-2 is controlled by E3 ubiquitin ligase Cbl.
19393627 2009 STAP-2 is phosphorylated at tyrosine-250 by Brk and modulates Brk-mediated STAT3 activation.
18573890 2008 STAP-2 negatively regulates both canonical and noncanonical NF-kappaB activation induced by Epstein-Barr virus-derived latent membrane protein 1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...