Property Summary

NCBI Gene PubMed Count 23
PubMed Score 154.97
PubTator Score 9.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ductal carcinoma in situ 1.400 1.6e-03
fibroadenoma 1.200 3.2e-02
group 3 medulloblastoma 1.200 1.2e-02
interstitial cystitis -1.300 4.6e-02
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.5e-03
lung adenocarcinoma 1.200 6.1e-09
lung cancer 1.300 1.8e-03
malignant mesothelioma -2.700 1.2e-06
non-small cell lung cancer 1.159 9.8e-13
spina bifida -1.810 2.3e-02
ulcerative colitis -1.700 1.5e-05

Gene RIF (14)

AA Sequence

MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEK      1 - 70
LTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLA     71 - 140
KEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREG    141 - 210
PKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAP    211 - 280
CTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPK    281 - 350
PPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH                     351 - 403
//

Text Mined References (24)

PMID Year Title