Property Summary

NCBI Gene PubMed Count 22
PubMed Score 71.92
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Microcephaly with chorioretinopathy, autosomal recessive 3 0.0 0.0
Disease Target Count P-value
subependymal giant cell astrocytoma 2287 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 3.0
Disease Target Count Z-score Confidence
Microcephaly 166 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma -1.794 1.9e-02

Gene RIF (2)

AA Sequence

MIHELLLALSGYPGSIFTWNKRSGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIEQYTGHVQQQD      1 - 70
HHPSQQGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLGDPHLSISHVNYFLDQFQLLFPSVMVVV     71 - 140
EQIKSQKIHGCQILETVYKHSCGGLPPVRSALEKILAVCHGVMYKQLSAWMLHGLLLDQHEEFFIKQGPS    141 - 210
SGNVSAQPEEDEEDLGIGGLTGKQLRELQDLRLIEEENMLAPSLKQFSLRVEILPSYIPVRVAEKILFVG    211 - 280
ESVQMFENQNVNLTRKGSILKNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDL    281 - 350
LGQLKIIKDFYLLGRGELFQAFIDTAQHMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIEY    351 - 420
HGKEHKADATQAREGPSRETSPREAPASGWAALGLSYKVQWPLHILFTPAVLEKYNVVFKYLLSVRRVQA    421 - 490
ELQHCWALQMQRKHLKSNQTDAIKWRLRNHMAFLVDNLQYYLQVDVLESQFSQLLHQINSTRDFESIRLA    491 - 560
HDHFLSNLLAQSFILLKPVFHCLNEILDLCHSFCSLVSQNLGPLDERGAAQLSILVKGFSRQSSLLFKIL    561 - 630
SSVRNHQINSDLAQLLLRLDYNKYYTQAGGTLGSFGM                                     631 - 667
//

Text Mined References (25)

PMID Year Title