Property Summary

NCBI Gene PubMed Count 19
PubMed Score 68.20
PubTator Score 6.42

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma -1.794 0.019


Accession Q9UGJ1 B3KNK6 Q969X3 Q9NVF0 GCP-4
Symbols 76P




  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (2)

25817018 Mutations in TUBGCP4 alter microtubule organization via the gamma-tubulin ring complex in autosomal-recessive microcephaly with chorioretinopathy.
20508983 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

SSVRNHQINSDLAQLLLRLDYNKYYTQAGGTLGSFGM                                     631 - 667

Text Mined References (22)

PMID Year Title
26213385 2015 ATF5 Connects the Pericentriolar Materials to the Proximal End of the Mother Centriole.
25817018 2015 Mutations in TUBGCP4 alter microtubule organization via the ?-tubulin ring complex in autosomal-recessive microcephaly with chorioretinopathy.
25416956 2014 A proteome-scale map of the human interactome network.
24561039 2014 Rab11 endosomes contribute to mitotic spindle organization and orientation.
21725292 2011 Crystal structure of ?-tubulin complex protein GCP4 provides insight into microtubule nucleation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
19946888 2010 Defining the membrane proteome of NK cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.