Property Summary

NCBI Gene PubMed Count 27
PubMed Score 45.98
PubTator Score 16.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000

Synonym

Accession Q9UGI9 Q4QQG8 Q4V779 Q9NRL1 AMPK gamma3
Symbols AMPKG3

Gene

PANTHER Protein Class (2)

Gene RIF (18)

PMID Text
23396962 Low PRKAA2 expression is associated with follicular lymphoma.
21344388 Knockdown of SIRT1 by its inhibitor or siRNA results in Tat-mediated reduction of phosphorylation of AMP-activated protein kinase (AMPK) and downstream acetyl-CoA carboxylase (ACC)
20821366 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20473479 Through the enhancement of skeletal muscle glucose uptake and increased mitochondrial content, the R225W mutation of the gene encoding AMP-activated protein kinase (AMPK)gamma(3)may significantly enhance exercise performance.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19836452 Purification and characterization of truncated human AMPK alpha 2 beta 2 gamma 3 heterotrimer from baculovirus-infected insect cells
19720090 Knockdown of SIRT1 by its inhibitor or siRNA results in Tat-mediated reduction of phosphorylation of AMP-activated protein kinase (AMPK) and downstream acetyl-CoA carboxylase (ACC)
19574280 Variants in genes for AMPKalpha2 and AMPKgamma3 were not associated with PCOS or its component traits.
More...

AA Sequence

MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGE      1 - 70
PPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSDCTASAAGSSTDDVELATEFP     71 - 140
ATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPGAQIYMRFMQEHTCYDAMATSSKLVIFDTML    141 - 210
EIKKAFFALVANGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGC    211 - 280
FKPLVSISPNDSLFEAVYTLIKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQD    281 - 350
LGIGTFRDLAVVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA    351 - 420
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLSPAGIDALGA     421 - 489
//

Text Mined References (32)

PMID Year Title
23396962 2013 Association of AMP-activated protein kinase with risk and progression of non-Hodgkin lymphoma.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21460634 2011 Ulk1-mediated phosphorylation of AMPK constitutes a negative regulatory feedback loop.
20821366 2011 Association study of energy homeostasis genes and antipsychotic-induced weight gain in patients with schizophrenia.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20473479 2010 Naturally occurring R225W mutation of the gene encoding AMP-activated protein kinase (AMPK)gamma(3) results in increased oxidative capacity and glucose uptake in human primary myotubes.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19836452 2010 Purification and characterization of truncated human AMPK alpha 2 beta 2 gamma 3 heterotrimer from baculovirus-infected insect cells.
19574280 2009 Association study of AMP-activated protein kinase subunit genes in polycystic ovary syndrome.
More...