Property Summary

NCBI Gene PubMed Count 30
PubMed Score 47.26
PubTator Score 16.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
medulloblastoma, large-cell 6241 9.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 9.7e-05

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (21)

AA Sequence

MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGE      1 - 70
PPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSDCTASAAGSSTDDVELATEFP     71 - 140
ATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPGAQIYMRFMQEHTCYDAMATSSKLVIFDTML    141 - 210
EIKKAFFALVANGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGC    211 - 280
FKPLVSISPNDSLFEAVYTLIKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQD    281 - 350
LGIGTFRDLAVVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA    351 - 420
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLSPAGIDALGA     421 - 489
//

Text Mined References (35)

PMID Year Title