Property Summary

NCBI Gene PubMed Count 46
PubMed Score 1139.23
PubTator Score 48.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
glioblastoma 1.100 2.1e-02
Breast cancer -1.100 1.2e-04
Chronic Lymphocytic Leukemia -1.670 5.3e-04
colon cancer -1.200 2.6e-02
cystic fibrosis -2.239 6.3e-07
group 3 medulloblastoma 1.500 1.8e-03
intraductal papillary-mucinous adenoma (... 1.500 4.1e-04
intraductal papillary-mucinous carcinoma... 1.300 1.9e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.1e-02
lung cancer -1.400 2.9e-04
lung carcinoma -1.500 1.1e-23
Multiple myeloma 1.244 3.7e-03
osteosarcoma -1.581 6.4e-03
ovarian cancer 1.500 1.0e-07
pancreatic ductal adenocarcinoma liver m... 1.398 1.1e-02
pituitary cancer -1.700 3.6e-06
primitive neuroectodermal tumor 1.100 8.9e-03
psoriasis -1.800 3.2e-04
spina bifida -1.480 3.6e-02

Gene RIF (26)

AA Sequence

MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDT      1 - 70
KYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGS     71 - 140
EGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPG    141 - 210
GDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIY    211 - 280
FWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCK    281 - 350
PCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRM    351 - 420
S//

Text Mined References (48)

PMID Year Title