Property Summary

NCBI Gene PubMed Count 43
Grant Count 79
R01 Count 22
Funding $12,472,338.43
PubMed Score 1098.38
PubTator Score 48.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q9UGI8 A4D0U6 Q9GZQ1 Q9HAJ9
Symbols TESS
TESS-2

Gene

TES

PDB

2XQN   2IYB  

Gene RIF (23)

PMID Text
26985820 we confirm that the TES promoter is unmethylated in normal adult and fetal tissues. Re-expression of TESTIN protein in acute lymphoblastic leukemia cells using expression plasmid transfection results in rapid cell death or cell cycle arrest.
26611125 VASP, zyxin and TES are tension-dependent members of focal adherens junctions independent of the alpha-catenin-vinculin module.
25824796 Loss of TES gene expression is associated with nasopharyngeal carcinoma.
25720371 TESTIN was hypermethylated in 43.7% endometrial cancer tissues (p < 0.001). Moreover, TESTIN hypermethylation was significantly correlated with advanced tumor stage, deep myometrial invasion and lymphatic node metastasis.
25498217 findings suggest that the TES gene is a novel tumor suppressor gene
25119600 Downregulation of TES was associated with breast cancer.
24929083 TESTIN was commonly downregulated in human endometrial carcinoma and was associated with poor prognostic markers.
23715752 A further significant correlation was observed between TES downregulation and the luminal B subtype independent of survivin expression.
22957844 TES, as a valuable marker of breast cancer prognosis, plays an important role in the development and progression of breast cancer. TES may be an effective novel target in breast cancer prevention and treatment.
22201996 Alterations of TES mRNA level may predict the location of metastasis. CAV1 possibly affect the cancer cell invasion
More...

AA Sequence

MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDT      1 - 70
KYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGS     71 - 140
EGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPG    141 - 210
GDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIY    211 - 280
FWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCK    281 - 350
PCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRM    351 - 420
S//

Text Mined References (45)

PMID Year Title
26985820 2016 TESTIN Induces Rapid Death and Suppresses Proliferation in Childhood B Acute Lymphoblastic Leukaemia Cells.
26611125 2015 VASP, zyxin and TES are tension-dependent members of Focal Adherens Junctions independent of the ?-catenin-vinculin module.
25824796 2015 Effects of TESTIN gene expression on proliferation and migration of the 5-8F nasopharyngeal carcinoma cell line.
25720371 2015 TESTIN was commonly hypermethylated and involved in the epithelial-mesenchymal transition of endometrial cancer.
25498217 2014 Downregulation of TES by hypermethylation in glioblastoma reduces cell apoptosis and predicts poor clinical outcome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25119600 2014 TES was epigenetically silenced and suppressed the epithelial-mesenchymal transition in breast cancer.
24929083 2014 TESTIN suppresses tumor growth and invasion via manipulating cell cycle progression in endometrial carcinoma.
23715752 2013 Differential expression of testin and survivin in breast cancer subtypes.
23145062 2012 Human ALKBH4 interacts with proteins associated with transcription.
More...