Property Summary

NCBI Gene PubMed Count 74
PubMed Score 261.64
PubTator Score 156.53

Knowledge Summary

Patent (15,692)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
periodontitis 269 1.32205843618445E-21
non-small cell lung cancer 2798 1.04028433295591E-11
posterior fossa group A ependymoma 1511 2.05721258972241E-10
ovarian cancer 8492 2.26502350310978E-8
atypical teratoid/rhabdoid tumor 1095 2.38619984259888E-8
sonic hedgehog group medulloblastoma 1482 9.42748280903396E-6
malignant mesothelioma 3163 1.2490004844102E-5
colon cancer 1475 1.76197647162723E-5
medulloblastoma, large-cell 6234 3.25949845933624E-5
acute quadriplegic myopathy 1157 2.46355688939611E-4
osteosarcoma 7933 3.36275218137309E-4
lung cancer 4473 0.0011325152303722
Pick disease 1893 0.00166378797619211
ulcerative colitis 2087 0.00548859240136934
type II diabetes mellitus and post-ischemic heart failure 89 0.00570918189536897
interstitial cystitis 2299 0.00756181697888752
astrocytic glioma 2241 0.022925729512804
subependymal giant cell astrocytoma 2287 0.0308965865709296
pancreatic carcinoma 567 0.0453600701282246
pancreatic cancer 2300 0.0453600701282251
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 2.0
Prostate cancer 172 0.0 2.0
Disease Target Count Z-score Confidence
Schizophrenia 503 4.512 2.3
Bipolar Disorder 266 3.266 1.6
Anorexia nervosa 59 3.074 1.5

Expression

Synonym

Accession Q9UGI6 B1ANX0 O43517 Q86VF9 Q8WXG7 SK3
Symbols SK3
hSK3
SKCA3
KCa2.3

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (65)

PMID Text
26710323 Patients with Dilated Cardiomyopathy and Sustained Monomorphic Ventricular Tachycardia Show Up-Regulation of KCNN3 and KCNJ2 Genes and CACNG8-Linked Left Ventricular Dysfunction
26370375 KCNN3 single-nucleotide polymorphism rs13376333 significantly increases the risk of Atrial Fibrillation.
25783396 Decreased SK3 expression in ganglionic bowel may explain the basis of persistent bowel symptoms in some patients following a properly performed pull-through operation for Hirschsprung's disease.
25730848 SK3 channel and mitochondrial ROS mediate NADPH oxidase-independent NETosis induced by calcium influx.
24978901 There was no significant difference in the genotype distributions or allele frequencies of the SNP rs1131820 between AF patients and controls.
24978672 Reduced SK3 expression attenuates endometrial cell migration and is associated with unsuccessful pregnancy outcomes.
24595308 Intermediate conductance Ca2+-activated K+ channels modulate human placental trophoblast syncytialization.
24434522 Differentiated dopaminergic neurons expressed low levels of SK2 channels and high levels of SK1 and SK3 channels.
24206670 Specific expression of hSK3 led to deficits in attention and sensory gating and heightened sensitivity to a psychomimetic drug
23792675 CaMKK/Akt/p300 cascade plays an important role in laminar stress-dependent induction of KCa2.3 and KCa3.1 expression, thereby regulating EC function and adaptation to hemodynamic changes.
More...

AA Sequence

MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQPQPPQLQQQQ      1 - 70
QQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGSQLNLNDH     71 - 140
LLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPLSRLSASRRNLIEAETEG    141 - 210
QPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRKNQNIGYKLGHRRA    211 - 280
LFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLF    281 - 350
VIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRL    351 - 420
YLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYH    421 - 490
DQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHV    491 - 560
HNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQA    561 - 630
NTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEA    631 - 700
RGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC                                      701 - 736
//

Text Mined References (76)

PMID Year Title
26710323 2015 Patients with Dilated Cardiomyopathy and Sustained Monomorphic Ventricular Tachycardia Show Up-Regulation of KCNN3 and KCNJ2 Genes and CACNG8-Linked Left Ventricular Dysfunction.
26370375 2015 KCNN3 SNP rs13376333 on Chromosome 1q21 Confers Increased Risk of Atrial Fibrillation.
25783396 2015 Altered distribution of small-conductance calcium-activated potassium channel SK3 in Hirschsprung's disease.
25730848 2015 SK3 channel and mitochondrial ROS mediate NADPH oxidase-independent NETosis induced by calcium influx.
24978901 2014 Association between SNP rs13376333 and rs1131820 in the KCNN3 gene and atrial fibrillation in the Chinese Han population.
24978672 2014 Small-conductance, calcium-activated potassium channel 3 (SK3) is a modulator of endometrial remodeling during endometrial growth.
24595308 2014 Intermediate conductance Ca2+-activated K+ channels modulate human placental trophoblast syncytialization.
24434522 2014 Subcellular expression and neuroprotective effects of SK channels in human dopaminergic neurons.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24206670 2013 Disruption of dopamine neuron activity pattern regulation through selective expression of a human KCNN3 mutation.
More...