Property Summary

Ligand Count 22
NCBI Gene PubMed Count 79
PubMed Score 272.09
PubTator Score 156.53

Knowledge Summary

Patent (15,692)

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.042 2.5e-04
astrocytic glioma 1.600 8.6e-03
atypical teratoid / rhabdoid tumor -1.400 1.1e-05
colon cancer -2.100 1.8e-05
ependymoma 1.200 1.5e-03
group 4 medulloblastoma -1.400 3.8e-03
interstitial cystitis 1.400 7.6e-03
lung cancer -1.200 1.1e-03
malignant mesothelioma 1.100 1.2e-05
medulloblastoma, large-cell -1.300 1.4e-03
non-small cell lung cancer -1.106 1.0e-11
osteosarcoma -1.263 3.4e-04
ovarian cancer 1.100 2.3e-08
pancreatic cancer 1.300 4.5e-02
pancreatic carcinoma 1.300 4.5e-02
periodontitis 1.500 1.3e-21
Pick disease 1.200 1.7e-03
subependymal giant cell astrocytoma 1.768 3.1e-02
type II diabetes mellitus and post-ische... 1.200 5.7e-03
ulcerative colitis 1.400 5.5e-03

Gene RIF (70)

AA Sequence

MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQPQPPQLQQQQ      1 - 70
QQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGSQLNLNDH     71 - 140
LLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPLSRLSASRRNLIEAETEG    141 - 210
QPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRKNQNIGYKLGHRRA    211 - 280
LFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLF    281 - 350
VIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRL    351 - 420
YLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYH    421 - 490
DQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHV    491 - 560
HNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQA    561 - 630
NTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEA    631 - 700
RGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC                                      701 - 736
//

Text Mined References (81)

PMID Year Title