Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.68
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
adrenocortical carcinoma 1427 1.94812357349657E-5
glioblastoma 5572 1.97738412545448E-5
adult high grade glioma 2148 4.5456209963635E-5
atypical teratoid / rhabdoid tumor 4369 2.34113598981159E-4
osteosarcoma 7933 3.58052221345306E-4
medulloblastoma, large-cell 6234 6.21187460812111E-4
ovarian cancer 8492 0.00635216117871748
acute myeloid leukemia 785 0.00761384420344996
subependymal giant cell astrocytoma 2287 0.0253296996924649
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0314296203488001
spina bifida 1064 0.0458977361311681

Expression

  Differential Expression (11)

Synonym

Accession Q9UGI0 B4DZ98 D3DRF4 Q5SQP6 Q69YK3
Symbols TRABID

Gene

PDB

5AF6   3ZRH  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (1)

PMID Text
22157957 Data show that the ankyrin-repeat ubiquitin-binding domain is crucial for TRABID efficiency and linkage specificity.

AA Sequence

MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDS      1 - 70
SARPRVKSSYSMENANKWSCHMCTYLNWPRAIRCTQCLSQRRTRSPTESPQSSGSGSRPVAFSVDPCEEY     71 - 140
NDRNKLNTRTQHWTCSVCTYENWAKAKRCVVCDHPRPNNIEAIELAETEEASSIINEQDRARWRGSCSSG    141 - 210
NSQRRSPPATKRDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAA    211 - 280
IEAYKSSGGDIARQLTADEVRLLNRPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPE    281 - 350
LTEQIRREIAASLHQRKGDFACYFLTDLVTFTLPADIEDLPPTVQEKLFDEVLDRDVQKELEEESPIINW    351 - 420
SLELATRLDSRLYALWNRTAGDCLLDSVLQATWGIYDKDSVLRKALHDSLHDCSHWFYTRWKDWESWYSQ    421 - 490
SFGLHFSLREEQWQEDWAFILSLASQPGASLEQTHIFVLAHILRRPIIVYGVKYYKSFRGETLGYTRFQG    491 - 560
VYLPLLWEQSFCWKSPIALGYTRGHFSALVAMENDGYGNRGAGANLNTDDDVTITFLPLVDSERKLLHVH    561 - 630
FLSAQELGNEEQQEKLLREWLDCCVTEGGVLVAMQKSSRRRNHPLVTQMVEKWLDRYRQIRPCTSLSDGE    631 - 700
EDEDDEDE                                                                  701 - 708
//

Text Mined References (13)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24768539 2014 K33-Linked Polyubiquitination of Coronin 7 by Cul3-KLHL20 Ubiquitin E3 Ligase Regulates Protein Trafficking.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
22157957 2011 An ankyrin-repeat ubiquitin-binding domain determines TRABID's specificity for atypical ubiquitin chains.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
19373254 2009 Molecular discrimination of structurally equivalent Lys 63-linked and linear polyubiquitin chains.
18281465 2008 Trabid, a new positive regulator of Wnt-induced transcription with preference for binding and cleaving K63-linked ubiquitin chains.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...