Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.48
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.200 7.6e-03
adrenocortical carcinoma -1.008 1.2e-02
adult high grade glioma -1.600 4.5e-05
atypical teratoid / rhabdoid tumor -1.300 2.3e-04
glioblastoma -1.300 1.6e-07
medulloblastoma, large-cell -1.100 6.2e-04
osteosarcoma -1.480 3.6e-04
ovarian cancer -1.200 1.9e-09
pancreatic ductal adenocarcinoma liver m... -1.201 3.1e-02
spina bifida -1.259 4.1e-02
subependymal giant cell astrocytoma -1.774 2.5e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDS      1 - 70
SARPRVKSSYSMENANKWSCHMCTYLNWPRAIRCTQCLSQRRTRSPTESPQSSGSGSRPVAFSVDPCEEY     71 - 140
NDRNKLNTRTQHWTCSVCTYENWAKAKRCVVCDHPRPNNIEAIELAETEEASSIINEQDRARWRGSCSSG    141 - 210
NSQRRSPPATKRDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAA    211 - 280
IEAYKSSGGDIARQLTADEVRLLNRPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAKCIPAMVCPE    281 - 350
LTEQIRREIAASLHQRKGDFACYFLTDLVTFTLPADIEDLPPTVQEKLFDEVLDRDVQKELEEESPIINW    351 - 420
SLELATRLDSRLYALWNRTAGDCLLDSVLQATWGIYDKDSVLRKALHDSLHDCSHWFYTRWKDWESWYSQ    421 - 490
SFGLHFSLREEQWQEDWAFILSLASQPGASLEQTHIFVLAHILRRPIIVYGVKYYKSFRGETLGYTRFQG    491 - 560
VYLPLLWEQSFCWKSPIALGYTRGHFSALVAMENDGYGNRGAGANLNTDDDVTITFLPLVDSERKLLHVH    561 - 630
FLSAQELGNEEQQEKLLREWLDCCVTEGGVLVAMQKSSRRRNHPLVTQMVEKWLDRYRQIRPCTSLSDGE    631 - 700
EDEDDEDE                                                                  701 - 708
//

Text Mined References (13)

PMID Year Title