Property Summary

NCBI Gene PubMed Count 67
Grant Count 35
R01 Count 26
Funding $4,131,895.43
PubMed Score 132.23
PubTator Score 100.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
interstitial lung disease 1.100 0.002
ependymoma 1.100 0.014
oligodendroglioma 1.900 0.001
psoriasis 1.800 0.000
osteosarcoma 1.473 0.000
chronic lymphosyte leukemia 1.100 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.300 0.000
sonic hedgehog group medulloblastoma -1.200 0.000
ovarian cancer -1.500 0.000
pituitary cancer 1.500 0.000

Gene RIF (55)

PMID Text
26188149 In title.
25821969 Significant methylation changes in the SLC23A2 and NCOR2 regulatory regions.
25645015 Together, these data clarify previous inconsistencies in the literature andimplicate SVCT2 as the pericyte ascorbate transporter.
25242204 Vitamin C supplementation significantly increases skeletal muscle SVCT2 protein expression.
25102111 ascorbic acid uptake mechanism, kinetics, and regulation by sodium dependent vitamin C transporter (SVCT2) in MDA-MB231, T47D and ZR-75-1 cells.
24815519 polymorphisms in SLC23A1/2 genes influenced ascorbate concentration in aqueous humor and lens nucleus.
24594434 We propose that the mitochondrial localization of SVCT2 is a property shared across cells, tissues, and species.
24401033 Demonstrate that the expression of SVCT2 transporter is significantly down-regulated in human grade 3 osteoarthritic tissues.
23999113 Low SVCT2 transporter is associated with Type I diabetes.
23990905 Genetic variation in the sodium-dependent vitamin C transporter 2 may have a role in acute coronary syndrome in women
More...

AA Sequence

MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKS      1 - 70
SLAETLDSTGSLDPQRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAVPFLLADAMCVGYDQWATSQL     71 - 140
IGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWKCNTTDVSVANGTAELLHTEHIWYP    141 - 210
RIREIQGAIIMSSLIEVVIGLLGLPGALLKYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLV    211 - 280
LLFSQYARNVKFPLPIYKSKKGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTD    281 - 350
ARQGVLLVAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIF    351 - 420
VEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQCGAALMLALGMIGKFSALFASLPDPVLGAL    421 - 490
FCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNPLVTGITGIDQVLNVLLTTAMFV    491 - 560
GGCVAFILDNTIPGTPEERGIRKWKKGVGKGNKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFVGYTW    561 - 630
KGLRKSDNSRSSDEDSQATG                                                      631 - 650
//

Text Mined References (71)

PMID Year Title
26188149 2015 Intracellular dehydroascorbic acid inhibits SVCT2-dependent transport of ascorbic acid in mitochondria.
25821969 2015 Methylation levels of SLC23A2 and NCOR2 genes correlate with spinal muscular atrophy severity.
25645015 2015 Ascorbic acid transport in brain microvascular pericytes.
25242204 2014 High-dose vitamin C supplementation increases skeletal muscle vitamin C concentration and SVCT2 transporter expression but does not alter redox status in healthy males.
25102111 2014 Molecular expression and functional activity of vitamin C specific transport system (SVCT2) in human breast cancer cells.
24815519 2014 Polymorphisms in sodium-dependent vitamin C transporter genes and plasma, aqueous humor and lens nucleus ascorbate concentrations in an ascorbate depleted setting.
24594434 2014 Mitochondrial ascorbic acid transport is mediated by a low-affinity form of the sodium-coupled ascorbic acid transporter-2.
24401033 2014 Comparative analysis of sodium coupled vitamin C transporter 2 in human osteoarthritis grade 1 and grade 3 tissues.
23999113 2013 Regulation of vitamin C transporter in the type 1 diabetic mouse bone and bone marrow.
23990905 2013 Variation in the sodium-dependent vitamin C transporter 2 gene is associated with risk of acute coronary syndrome among women.
More...