Property Summary

NCBI Gene PubMed Count 72
PubMed Score 147.08
PubTator Score 100.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cholestasis 155 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Scurvy 10 3.715 1.9

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 7.1e-06
chronic lymphosyte leukemia 1.100 2.3e-07
ependymoma 1.100 1.4e-02
interstitial lung disease 1.100 2.3e-03
medulloblastoma, large-cell -1.300 1.3e-04
oligodendroglioma 1.300 1.1e-03
osteosarcoma 1.020 3.1e-03
ovarian cancer -1.500 3.4e-10
pituitary cancer 1.500 1.2e-04
psoriasis 1.300 2.8e-06
sonic hedgehog group medulloblastoma -1.200 1.6e-06

Gene RIF (60)

AA Sequence

MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKS      1 - 70
SLAETLDSTGSLDPQRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAVPFLLADAMCVGYDQWATSQL     71 - 140
IGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWKCNTTDVSVANGTAELLHTEHIWYP    141 - 210
RIREIQGAIIMSSLIEVVIGLLGLPGALLKYIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLV    211 - 280
LLFSQYARNVKFPLPIYKSKKGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTD    281 - 350
ARQGVLLVAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIF    351 - 420
VEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQCGAALMLALGMIGKFSALFASLPDPVLGAL    421 - 490
FCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNPLVTGITGIDQVLNVLLTTAMFV    491 - 560
GGCVAFILDNTIPGTPEERGIRKWKKGVGKGNKSLDGMESYNLPFGMNIIKKYRCFSYLPISPTFVGYTW    561 - 630
KGLRKSDNSRSSDEDSQATG                                                      631 - 650
//

Text Mined References (76)

PMID Year Title