Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.09
PubTator Score 0.29

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
20205591 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19833159 Observational study of gene-disease association. (HuGE Navigator)
17684544 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFID      1 - 70
ICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVL     71 - 140
CNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTP    141 - 210
FLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSV    211 - 280
VTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY                                 281 - 321
//

Text Mined References (11)

PMID Year Title
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20205591 2010 Host determinants of HIV-1 control in African Americans.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19833159 2010 Sequence variations at the human leukocyte antigen-linked olfactory receptor cluster do not influence female preferences for male odors.
17684544 2007 Systematic association mapping identifies NELL1 as a novel IBD disease gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
More...