Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.09
PubTator Score 0.29

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFID      1 - 70
ICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVL     71 - 140
CNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTP    141 - 210
FLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSV    211 - 280
VTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY                                 281 - 321
//

Text Mined References (11)

PMID Year Title