Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.37
PubTator Score 10.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell -1.200 9.4e-06

Gene RIF (5)

AA Sequence

MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKL      1 - 70
LNEKERELRETEHLLHDENEDLRKLAENEITLCQKEITQLKHQIILLLVPSEETDENDLILEVTAGVGGQ     71 - 140
EAMLFTSEIFDMYQQYAAFKRWHFETLEYFPSELGGLRHASASIGGSEAYRHMKFEGGVHRVQRVPKTEK    141 - 210
QGRVHTSTMTVAILPQPTEINLVINPKDLRIDTKRASGAGGQHVNTTDSAVRIVHLPTGVVSECQQERSQ    211 - 280
LKNKELAMTKLRAKLYSMHLEEEINKRQNARKIQIGSKGRSEKIRTYNFPQNRVTDHRINKTLHDLETFM    281 - 350
QGDYLLDELVQSLKEYADYESLVEIISQKV                                            351 - 380
//

Text Mined References (15)

PMID Year Title