Property Summary

NCBI Gene PubMed Count 15
Grant Count 31
R01 Count 22
Funding $3,383,911.97
PubMed Score 57.68
PubTator Score 20.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Whipple disease 5 3.054 1.5

Expression

Gene RIF (6)

PMID Text
26578517 Data suggest that MIOX expression/activity is up-regulated in kidneys tubules during oxidative stress (as in obesity and diabetic nephropathy); up-regulation of MIOX activity is related to phosphorylation of serine/threonine residues.
19896870 results demonstrated that the polymorphism (rs761745) in the promoter region of myo-inositol oxygenase(MIOX) gene may be associated with the development of type 1 diabetes mellitus in our studied population
19896870 Observational study of gene-disease association. (HuGE Navigator)
15778219 expression of MIOX is up-regulated by a positive feedback mechanism where xylitol, one of the products of MI catabolism via the glucuronate-xylulose pathway, induces an overexpression of MIOX
15504367 Molecular cloning and characterization of myo-inositol oxygenase as a 33kDa protein.
11716759 myo-inositol oxygenase (MIOX)

AA Sequence

MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKK      1 - 70
MTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVV     71 - 140
GDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLP    141 - 210
PEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCP    211 - 280
GILSW                                                                     281 - 285
//

Text Mined References (15)

PMID Year Title
26578517 2016 Transcriptional and Translational Modulation of myo-Inositol Oxygenase (Miox) by Fatty Acids: IMPLICATIONS IN RENAL TUBULAR INJURY INDUCED IN OBESITY AND DIABETES.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19896870 Polymorphisms of myo-inositol oxygenase gene are associated with Type 1 diabetes mellitus.
18364358 2008 Structural and biophysical characterization of human myo-inositol oxygenase.
15778219 2005 Up-regulation of human myo-inositol oxygenase by hyperosmotic stress in renal proximal tubular epithelial cells.
15504367 2004 Molecular cloning, expression, and characterization of myo-inositol oxygenase from mouse, rat, and human kidney.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...