Property Summary

NCBI Gene PubMed Count 16
PubMed Score 60.04
PubTator Score 20.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Kidney disease 430 3.128 1.6
Whipple disease 6 3.021 1.5

Expression

Gene RIF (7)

AA Sequence

MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKK      1 - 70
MTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVV     71 - 140
GDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLP    141 - 210
PEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDLYTKCPDLPDVDKLRPYYQGLIDKYCP    211 - 280
GILSW                                                                     281 - 285
//

Text Mined References (16)

PMID Year Title